Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantGRO-α/KC/CXCL1, Mouse (CHO-expressed)

Growth-regulated Alpha Protein (GRO), also known as CXCL-1, GRO1, MGSA and SCYB1, is a chemokine belonging to the intercrine alpha (Chemokine CXC) family. It is expressed mainly by macrophages, neutrophils and epithelial cells. GRO signals through chemokine receptor CXCR1 and CXCR2, and functions to chemoattract and activate neutrophils and basophils. It is also a hematoregulatory chemokine, which suppresses hematopoietic progenitor cell proliferation. GRO has also been reported to play a role in spinal cord development, angiogenesis, wound healing and tumorigenesis.

Product Specifications

Product Name Alternative

CXCL-1, GRO1, MGSA, SCYB1

Source

CHO

Field of Research

Immunology & Inflammation

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE and HPLC.

Bioactivity

Active at 10 ng/ml, measured in a tube formation assay using HUVEC cells.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

5-7 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Mouse GRO remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Mouse GRO should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

APIANELRCQCLQTMAGIHLKNIQSLKVLPSGPHCTQTEVIATLKNGREACLDPEAPLVQKIVQKMLKGVPK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human ACADM/MCAD Protein (His Tag)
PKSH032032-01 10 µg

Recombinant Human ACADM/MCAD Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human ACADM/MCAD Protein (His Tag)
PKSH032032-02 50 µg

Recombinant Human ACADM/MCAD Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Androgen Receptor (CT) Monoclonal Antibody
AN301437L-01 50 µL

Recombinant Androgen Receptor (CT) Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Androgen Receptor (CT) Monoclonal Antibody
AN301437L-02 100 µL

Recombinant Androgen Receptor (CT) Monoclonal Antibody

Sign In for Pricing
View Details
Human ZBTB46 activation kit by CRISPRa
GA115385 1 Kit

Human ZBTB46 activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue Total RNA, Pancreas, ectopic
CR561949 5 µg

Tissue Total RNA, Pancreas, ectopic

Sign In for Pricing
View Details