Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantGRO-α/KC/CXCL1, Mouse (CHO-expressed)

Growth-regulated Alpha Protein (GRO), also known as CXCL-1, GRO1, MGSA and SCYB1, is a chemokine belonging to the intercrine alpha (Chemokine CXC) family. It is expressed mainly by macrophages, neutrophils and epithelial cells. GRO signals through chemokine receptor CXCR1 and CXCR2, and functions to chemoattract and activate neutrophils and basophils. It is also a hematoregulatory chemokine, which suppresses hematopoietic progenitor cell proliferation. GRO has also been reported to play a role in spinal cord development, angiogenesis, wound healing and tumorigenesis.

Product Specifications

Product Name Alternative

CXCL-1, GRO1, MGSA, SCYB1

Source

CHO

Field of Research

Immunology & Inflammation

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE and HPLC.

Bioactivity

Active at 10 ng/ml, measured in a tube formation assay using HUVEC cells.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

5-7 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Mouse GRO remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Mouse GRO should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

APIANELRCQCLQTMAGIHLKNIQSLKVLPSGPHCTQTEVIATLKNGREACLDPEAPLVQKIVQKMLKGVPK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Block, for Microtube Strips (2.0ml) 6 strips
BSW2MTS 1 Each

Block, for Microtube Strips (2.0ml) 6 strips

Sign In for Pricing
View Details
CD14 (Monocyte / Macrophage Marker) (rLPSR/2408), CF405S conjugate, 0.1mg/mL
BNC043788-500 1x 500 µL

CD14 (Monocyte / Macrophage Marker) (rLPSR/2408), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Srek1ip1 Mouse Gene Knockout Kit (CRISPR)
KN516707 1 Kit

Srek1ip1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
HOXB3 (Center) Rabbit Polyclonal Antibody
AP52078PU-N 400 µL

HOXB3 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
IL-1 beta Antibody
KC-024-01 50 μL

IL-1 beta Antibody

Sign In for Pricing
View Details
IL-1 beta Antibody
KC-024-02 100 µL

IL-1 beta Antibody

Sign In for Pricing
View Details