Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat CU protein

This Rat CU protein spans the amino acid sequence from region 26-100aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Dutch elm disease toxin

UniProt

Q06153

Expression Region

26-100aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Ophiostoma ulmi (Dutch elm disease fungus)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

9.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SDSYDPCTGLLQKSPQCCNTDILGVANLDCHGPPSVPTSPSQFQASCVADGGRSARCCTLSLLGLALVCTDPVGI

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

BioMag® BioMag Goat anti-Mouse IgG
BM549-50 50 mL

BioMag® BioMag Goat anti-Mouse IgG

Sign In for Pricing
View Details
RPS6KB2 Recombinant Antibody, AbBy Fluor™ 750 Conjugated
bsm-62972R-BF750-01 20 µL

RPS6KB2 Recombinant Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
RPS6KB2 Recombinant Antibody, AbBy Fluor™ 750 Conjugated
bsm-62972R-BF750-02 100 µL

RPS6KB2 Recombinant Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
Anti-LRRTM2 Antibody FL550 Conjugate
75-364-FL550 200 µL

Anti-LRRTM2 Antibody FL550 Conjugate

Sign In for Pricing
View Details
DIS3 (Exosome Complex Exonuclease RRP44, Protein DIS3 Homolog, Ribosomal RNA-processing Protein 44, KIAA1008, RRP44) (MaxLight 750) discontinued
125859-ML750 100 µL

DIS3 (Exosome Complex Exonuclease RRP44, Protein DIS3 Homolog, Ribosomal RNA-processing Protein 44, KIAA1008, RRP44) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Recombinant Vitis vinifera ATP synthase subunit c, chloroplastic (atpH)
orb2936377-01 20 µg

Recombinant Vitis vinifera ATP synthase subunit c, chloroplastic (atpH)

Sign In for Pricing
View Details