Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Vitis vinifera ATP synthase subunit c, chloroplastic (atpH)

This Recombinant Vitis vinifera ATP synthase subunit c, chloroplastic (atpH) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, chloroplastic, ATP synthase F (0) sector subunit c, ATPase subunit III, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q0ZJ33

Expression Region

1-81

Origin

Vitis vinifera (Grape)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNPLISAASVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFM EALTIYGLVVALALLFANPFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tspan1 Rabbit Polyclonal Antibody (FITC)
orb2603394 100 µg

Tspan1 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
CISD2 Polyclonal Antibody
JOT-AP07715-01 20 µL

CISD2 Polyclonal Antibody

Sign In for Pricing
View Details
CISD2 Polyclonal Antibody
JOT-AP07715-02 50 μL

CISD2 Polyclonal Antibody

Sign In for Pricing
View Details
CISD2 Polyclonal Antibody
JOT-AP07715-03 100 µL

CISD2 Polyclonal Antibody

Sign In for Pricing
View Details
Tmlhe siRNA Oligos set (Mouse)
47127174 3x 5 nmol

Tmlhe siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
Rat Monoclonal WIF-1 Antibody (RM0144-3M51)
NBP1-22520-0.025mg 0.025 mg

Rat Monoclonal WIF-1 Antibody (RM0144-3M51)

Sign In for Pricing
View Details