Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sheep IFNG protein

This Sheep IFNG protein spans the amino acid sequence from region 24-166a. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IFNG

UniProt

P17773

Expression Region

24-166a

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Ovis aries (Sheep)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QGPFFKEIENLKEYFNASNPDVAKGGPLFSEILKNWKEESDKKIIQSQIVSFYFKLFENLKDNQVIQRSMDIIKQDMFQKFLNGSSEKLEDFKRLIQIPVDDLQIQRKAINELIKVMNDLSPKSNLRKRKRSQNLFRGRRASM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BUD13, CT (BUD13, BUD13 homolog) (MaxLight 405) discontinued
032629-ML405 100 µL

BUD13, CT (BUD13, BUD13 homolog) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Recombinant Bacillus cereus Holin-like protein CidA (cidA)
orb2922024-01 20 µg

Recombinant Bacillus cereus Holin-like protein CidA (cidA)

Sign In for Pricing
View Details
Recombinant Bacillus cereus Holin-like protein CidA (cidA)
orb2922024-02 100 µg

Recombinant Bacillus cereus Holin-like protein CidA (cidA)

Sign In for Pricing
View Details
Anti-EIF5A Antibody Picoband®
A01727-3 100 µg/Vial

Anti-EIF5A Antibody Picoband®

Sign In for Pricing
View Details
Phospho-PSD95 (Ser295) Antibody
MBS9600718-01 0.1 mL

Phospho-PSD95 (Ser295) Antibody

Sign In for Pricing
View Details
Phospho-PSD95 (Ser295) Antibody
MBS9600718-02 0.2 mL

Phospho-PSD95 (Ser295) Antibody

Sign In for Pricing
View Details