Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus cereus Holin-like protein CidA (cidA)

This Recombinant Bacillus cereus Holin-like protein CidA (cidA) spans the amino acid sequence from region 1-121.

Product Specifications

Product Name Alternative

Holin-like protein CidA

UniProt

B9IUJ0

Expression Region

1-121

Origin

Bacillus cereus (strain Q1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKWWKLSGQILLLFCFAWTGEWIAKQAHLPVPGSIIGIFLLLISLKFNLVKKEWIQDGAD FLLKELILFFIPSAVAVIRYKDTLSQYGIDLILIIMISTLCVTLVTGLLTELLLKRKGSV Q

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Catenin, beta (p120) (CTNNB1/2099), CF568 conjugate, 0.1mg/mL
BNC682099-100 1x 100 µL

Catenin, beta (p120) (CTNNB1/2099), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TNFSF10 Polyclonal Antibody
E-AB-90335-01 60 µL

TNFSF10 Polyclonal Antibody

Sign In for Pricing
View Details
TNFSF10 Polyclonal Antibody
E-AB-90335-02 120 µL

TNFSF10 Polyclonal Antibody

Sign In for Pricing
View Details
TNFSF10 Polyclonal Antibody
E-AB-90335-03 200 µL

TNFSF10 Polyclonal Antibody

Sign In for Pricing
View Details
Triethylammonium Sulfate
TRC-T797470-1G 1 g

Triethylammonium Sulfate

Sign In for Pricing
View Details
Granzyme B Antibody
KC-9809-01 50 μL

Granzyme B Antibody

Sign In for Pricing
View Details