Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus cereus Holin-like protein CidA (cidA)

This Recombinant Bacillus cereus Holin-like protein CidA (cidA) spans the amino acid sequence from region 1-121.

Product Specifications

Product Name Alternative

Holin-like protein CidA

UniProt

B9IUJ0

Expression Region

1-121

Origin

Bacillus cereus (strain Q1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKWWKLSGQILLLFCFAWTGEWIAKQAHLPVPGSIIGIFLLLISLKFNLVKKEWIQDGAD FLLKELILFFIPSAVAVIRYKDTLSQYGIDLILIIMISTLCVTLVTGLLTELLLKRKGSV Q

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse IL-3 Antibody Pair Set
E-KAB-0695 50 µL & 100 µg

Mouse IL-3 Antibody Pair Set

Sign In for Pricing
View Details
Human Sideroflexin 1 (SFXN1) ELISA Kit
RD-SFXN1-Hu-01 96 Tests

Human Sideroflexin 1 (SFXN1) ELISA Kit

Sign In for Pricing
View Details
Human Sideroflexin 1 (SFXN1) ELISA Kit
RD-SFXN1-Hu-02 48 Tests

Human Sideroflexin 1 (SFXN1) ELISA Kit

Sign In for Pricing
View Details
6-Chloropurine-9-(2,3-isopropylidene-b-D-ribofuranoside)
TRC-C379885-5G 5 g

6-Chloropurine-9-(2,3-isopropylidene-b-D-ribofuranoside)

Sign In for Pricing
View Details
Mucin-2 Antibody
KC-2511-01 50 μL

Mucin-2 Antibody

Sign In for Pricing
View Details
Mucin-2 Antibody
KC-2511-02 100 µL

Mucin-2 Antibody

Sign In for Pricing
View Details