Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human COBRA1 protein

This Human COBRA1 protein spans the amino acid sequence from region 8-199aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

COBRA1 KIAA1182 NELFB

UniProt

Q8WX92

Expression Region

8-199aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

48.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is GST-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LGVANGEDLKETLTNCTEPLKAIEQFQTENGVLLPSLQSALPFLDLHGTPRLEFHQSVFDELRDKLLERVSAIASEGKAEERYKKLEDLLEKSFSLVKMPSLQPVVMCVMKHLPKVPEKKLKLVMADKELYRACAVEVKRQIWQDNQALFGDEVSPLLKQYILEKESALFSTELSVLHNFFSPSPKTRRQGE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Testis-expressed protein 51 (TEX51), partial
orb3004379-01 20 µg

Recombinant Human Testis-expressed protein 51 (TEX51), partial

Sign In for Pricing
View Details
Recombinant Human Testis-expressed protein 51 (TEX51), partial
orb3004379-02 100 µg

Recombinant Human Testis-expressed protein 51 (TEX51), partial

Sign In for Pricing
View Details
Recombinant Human Testis-expressed protein 51 (TEX51), partial
orb3004379-03 1 mg

Recombinant Human Testis-expressed protein 51 (TEX51), partial

Sign In for Pricing
View Details
Ankyrin repeat domain-containing protein 13C (ANKRD13C) Human ELISA Kit
B5173 96 Tests

Ankyrin repeat domain-containing protein 13C (ANKRD13C) Human ELISA Kit

Sign In for Pricing
View Details
HSD17B14 Protein Lysate
OCOA10303-20UG 20 µg

HSD17B14 Protein Lysate

Sign In for Pricing
View Details
Rat Monoclonal IL-32 Antibody (373821) [Janelia Fluor 635]
FAB30402JF635 0.1 mL

Rat Monoclonal IL-32 Antibody (373821) [Janelia Fluor 635]

Sign In for Pricing
View Details