Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Testis-expressed protein 51 (TEX51), partial

This Recombinant Human Testis-expressed protein 51 (TEX51), partial spans the amino acid sequence from region 16-137. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Testis-expressed protein 51 TEX51

UniProt

A0A1B0GUA7

Expression Region

16-137

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KNCLRCWPELSALIDYDLQILWVTPGPPTELSQNRDHLEEETAKFFTQVHQAIKTLRDDKTVLLEEIYTHKNLFTERLNKISDGLKEKDIQSTLKVTSCADCRTHFLSCNDPTFCPARNRRT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

β-Amyloid, 1-42
A2275-74F 1 mg

β-Amyloid, 1-42

Sign In for Pricing
View Details
Zfp598 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K3569306 1.0 µg DNA

Zfp598 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
pCR4-TOPO-MXD1 Plasmid
PVT33224 2 µg

pCR4-TOPO-MXD1 Plasmid

Sign In for Pricing
View Details
HAND2 (Heart and Neural Crest Derivatives Expressed 2, DHAND2, FLJ16260, Hed, MGC125303, MGC125304, Thing2, bHLHa26, dHand) (Biotin)
246909-Biotin 100 µL

HAND2 (Heart and Neural Crest Derivatives Expressed 2, DHAND2, FLJ16260, Hed, MGC125303, MGC125304, Thing2, bHLHa26, dHand) (Biotin)

Sign In for Pricing
View Details
Chicken Polyclonal ATG5 Antibody [CoraFluor 1]
NBP1-76992CL1 0.1 mL

Chicken Polyclonal ATG5 Antibody [CoraFluor 1]

Sign In for Pricing
View Details
Top2b sgRNA CRISPR Lentivector (Rat) (Target 1)
K7449202 1.0 µg DNA

Top2b sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details