Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Testis-expressed protein 51 (TEX51), partial

This Recombinant Human Testis-expressed protein 51 (TEX51), partial spans the amino acid sequence from region 16-137. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Testis-expressed protein 51 TEX51

UniProt

A0A1B0GUA7

Expression Region

16-137

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KNCLRCWPELSALIDYDLQILWVTPGPPTELSQNRDHLEEETAKFFTQVHQAIKTLRDDKTVLLEEIYTHKNLFTERLNKISDGLKEKDIQSTLKVTSCADCRTHFLSCNDPTFCPARNRRT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Catalase Adenovirus (Mouse)
54226054 250 µL

Catalase Adenovirus (Mouse)

Sign In for Pricing
View Details
DR6 (Death Receptor6)
MBS600256-01 0.1 mg

DR6 (Death Receptor6)

Sign In for Pricing
View Details
DR6 (Death Receptor6)
MBS600256-02 5x 0.1 mg

DR6 (Death Receptor6)

Sign In for Pricing
View Details
Human Carbonic Anhydrase VA Affinity Purified Polyclonal Ab
AF3049-SP 25 µg

Human Carbonic Anhydrase VA Affinity Purified Polyclonal Ab

Sign In for Pricing
View Details
RAC1 Rabbit Polyclonal Antibody
orb2955028-01 50 µg

RAC1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
RAC1 Rabbit Polyclonal Antibody
orb2955028-02 100 µg

RAC1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details