Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human KIAA1377 protein

This Human KIAA1377 protein spans the amino acid sequence from region 559-670aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

KIAA1377

UniProt

Q9P2H0

Expression Region

559-670aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

HKKMKYNIHERNGVRFLKSILKKESKYEHGYLKALIINQSFKFGNQKAAAIRDSIELTKEKGAEIPKTIKKLRWFDETSNIENNAENSHSLKNKTGTTQQHSQQFHIQSGAG

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RANGAP1 Rabbit Polyclonal Antibody
orb330854 100 µL

RANGAP1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
KLK3 Peptide - middle region (AAP41879)
AAP41879-100UG 100 µg

KLK3 Peptide - middle region (AAP41879)

Sign In for Pricing
View Details
VHL Ligand 14
HY-150803-01 1 mg

VHL Ligand 14

Sign In for Pricing
View Details
VHL Ligand 14
HY-150803-02 5 mg

VHL Ligand 14

Sign In for Pricing
View Details
VHL Ligand 14
HY-150803-03 10 mg

VHL Ligand 14

Sign In for Pricing
View Details
VHL Ligand 14
HY-150803-04 25 mg

VHL Ligand 14

Sign In for Pricing
View Details