Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E.coli cry1Fb protein

This E.coli cry1Fb protein spans the amino acid sequence from region 984-1169aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cry1Fb

UniProt

O66377

Expression Region

984-1169aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Bacillus thuringiensis subsp. morrisoni

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

47.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is GST-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VKGHVDVEEQNNHRSVLVVPEWEAEVSQEVRVCPGRGYILRVTAYKEGYGEGCVTIHEVDNNTDELKFSSNCEKEQVYPGNTVACNDYNKNHGANACSSRNGGYDESYESNSSIPADYAPVYEEEAYTDGQRGNPCEFNRGHTPLPAGYVTAELEYFPETDTVWVEIGETEGTFIVDSVELLLMEE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IMMT Antibody / MIC60
F54800-0.4ML 0.4 mL

IMMT Antibody / MIC60

Sign In for Pricing
View Details
Bacterial rplL protein
orb358639-01 20 µg

Bacterial rplL protein

Sign In for Pricing
View Details
Bacterial rplL protein
orb358639-02 100 µg

Bacterial rplL protein

Sign In for Pricing
View Details
Bacterial rplL protein
orb358639-03 1 mg

Bacterial rplL protein

Sign In for Pricing
View Details
NOTCH1 Knockout Raji Polyclonal Cells
ARG1334 1 Million

NOTCH1 Knockout Raji Polyclonal Cells

Sign In for Pricing
View Details
Catenin alpha1 (CTNNA1, Catenin (Cadherin-associated Protein), alpha 1, 102kDa, HGNC:2509, CAP102, FLJ36832, alpha 1 (102kD), alpha-E-Catenin, alpha-Catenin, alphaE-Catenin) discontinued
C2069-40 50 µL

Catenin alpha1 (CTNNA1, Catenin (Cadherin-associated Protein), alpha 1, 102kDa, HGNC:2509, CAP102, FLJ36832, alpha 1 (102kD), alpha-E-Catenin, alpha-Catenin, alphaE-Catenin) discontinued

Sign In for Pricing
View Details