Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial rplL protein

This Bacterial rplL protein spans the amino acid sequence from region 1-122aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

RplL, SAV0540, 50S ribosomal protein L7/L12

UniProt

P66061

Expression Region

1-122aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Staphylococcus aureus (strain Mu50 / ATCC 700699)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MANHEQIIEAIKEMSVLELNDLVKAIEEEFGVTAAAPVAVAGAAGGADAAAEKTEFDVELTSAGSSKIKVVKAVKEATGLGLKDAKELVDGAPKVIKEALPKEEAEKLKEQLEEVGATVELK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

α-Glucosidase Inhibitor Screening Kit (Colorimetric)
K938-100 100 Assays

α-Glucosidase Inhibitor Screening Kit (Colorimetric)

Sign In for Pricing
View Details
CCL14 Antibody, Biotin conjugated
CSB-PA08947D0Rb-01 50 µg

CCL14 Antibody, Biotin conjugated

Sign In for Pricing
View Details
CCL14 Antibody, Biotin conjugated
CSB-PA08947D0Rb-02 100 µg

CCL14 Antibody, Biotin conjugated

Sign In for Pricing
View Details
RANKL Antibody
MBS8504249-01 0.1 mg

RANKL Antibody

Sign In for Pricing
View Details
RANKL Antibody
MBS8504249-02 0.1 mL (AF405L)

RANKL Antibody

Sign In for Pricing
View Details
RANKL Antibody
MBS8504249-03 0.1 mL (AF405S)

RANKL Antibody

Sign In for Pricing
View Details