Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial rplL protein

This Bacterial rplL protein spans the amino acid sequence from region 1-122aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

RplL, SAV0540, 50S ribosomal protein L7/L12

UniProt

P66061

Expression Region

1-122aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Staphylococcus aureus (strain Mu50 / ATCC 700699)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MANHEQIIEAIKEMSVLELNDLVKAIEEEFGVTAAAPVAVAGAAGGADAAAEKTEFDVELTSAGSSKIKVVKAVKEATGLGLKDAKELVDGAPKVIKEALPKEEAEKLKEQLEEVGATVELK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RANK BioAssayTM ELISA Kit, Human
144022 96 Tests

RANK BioAssayTM ELISA Kit, Human

Sign In for Pricing
View Details
POLR2K 3'UTR Luciferase Stable Cell Line
TU018433 1.0 mL

POLR2K 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
PAAF1 Human Over-expression Lysate
orb1371431 20 µg

PAAF1 Human Over-expression Lysate

Sign In for Pricing
View Details
PCIF1 siRNA (Mouse)
CRN2689-01 15 nmol

PCIF1 siRNA (Mouse)

Sign In for Pricing
View Details
PCIF1 siRNA (Mouse)
CRN2689-02 30 nmol

PCIF1 siRNA (Mouse)

Sign In for Pricing
View Details
IRF3 (Phospho-Ser386) Rabbit mAb
RDSA65180 100 µL

IRF3 (Phospho-Ser386) Rabbit mAb

Sign In for Pricing
View Details