Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Transthyretin protein

This Mouse Transthyretin protein spans the amino acid sequence from region 21-147aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Amyloidosis I protein, ATTR protein, CTS protein, CTS1 protein, HEL111 protein, HsT2651 protein, PALB protein, Prealbumin amyloidosis type I protein, TBPA protein, Transthyretin protein, TTR protein, TTR protein protein

UniProt

P07309

Expression Region

21-147aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial of the full length of 21-147aa of His-SUMO-tag and expression region is 23-147aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GPAGAGESKCPLMVKVLDAVRGSPAVDVAVKVFKKTSEGSWEPFASGKTAESGELHGLTTDEKFVEGVYRVELDTKSYWKTLGISPFHEFADVVFTANDSGHRHYTIAALLSPYSYSTTAVVSNPQN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human CA199 (FUT3) Protein (His Tag)
PDEH100706-01 20 µg

Recombinant Human CA199 (FUT3) Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human CA199 (FUT3) Protein (His Tag)
PDEH100706-02 100 µg

Recombinant Human CA199 (FUT3) Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human CA199 (FUT3) Protein (His Tag)
PDEH100706-03 500 µg

Recombinant Human CA199 (FUT3) Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human CA199 (FUT3) Protein (His Tag)
PDEH100706-04 1 mg

Recombinant Human CA199 (FUT3) Protein (His Tag)

Sign In for Pricing
View Details
SPRED3 (NM_001039616) Human Over-expression Lysate
LC422092 20 µg

SPRED3 (NM_001039616) Human Over-expression Lysate

Sign In for Pricing
View Details
Tmem184a Mouse Gene Knockout Kit (CRISPR)
KN517772 1 Kit

Tmem184a Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details