Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UCHL3, Mouse (His, solution)

UCHL3 Protein, a ubiquitin carboxyl-terminal hydrolase, is involved in the regulation of cellular processes and protein degradation. It is particularly expressed in the testes and plays a vital role in spermatogenesis. UCHL3 Protein's significance in male fertility and its potential as a therapeutic target in reproductive disorders make it a subject of interest in reproductive medicine. UCHL3 Protein, Mouse (His, solution) is the recombinant mouse-derived UCHL3 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

UCHL3 Protein, Mouse (His, solution), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/uchl3-protein-mouse-his-solution.html

Purity

97.00

Smiles

EGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMEPELLSMVPRPVCAVLLLFPITEKYEVFRTEEEEKIKSQGQDVTSSVYFMKQTISNACGTIGLIHAIANNKDKMHFESGSTLKKFLEESVSMSPEERAKFLENYDAIRVTHETSAHEGQTEAPSIDEKVDLHFIALVHVDGHLYELDGRKPFPINHGKTSDETLLEDAIEVCKKFMERDPDELRFNAIALSAA

Molecular Formula

50933 (Gene_ID) Q9JKB1 (E2-A230) (Accession)

Molecular Weight

Approximately 26 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FATP2 (SLC27A2) Human Over-expression Lysate
orb1365966 20 µg

FATP2 (SLC27A2) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Human TNFRSF10B
Z102249 1 mg

Recombinant Human TNFRSF10B

Sign In for Pricing
View Details
Anti-CD133/PROM1 Antibody (CMab-43)
T9901A-1562-01 1 mg

Anti-CD133/PROM1 Antibody (CMab-43)

Sign In for Pricing
View Details
Anti-CD133/PROM1 Antibody (CMab-43)
T9901A-1562-02 5 mg

Anti-CD133/PROM1 Antibody (CMab-43)

Sign In for Pricing
View Details
STAT3 HiBiT degrader 1
HY-169370 1 Each

STAT3 HiBiT degrader 1

Sign In for Pricing
View Details
Rat Cyclin-dependent kinase 5 (CDK5) ELISA Kit
YP-W31782-01 48 Tests

Rat Cyclin-dependent kinase 5 (CDK5) ELISA Kit

Sign In for Pricing
View Details