Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPAG16 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Sperm associated antigen 16

Gene Aliases

PF20; pf20 protein homolog; sperm-associated antigen 16 protein; sperm-associated WD repeat protein; WD repeat domain 29; WDR29.

Gene ID

79582

Accession Number

NP_001020607

Reactivity

Homo sapiens|Human

Target

Necessary for sperm flagellar function. Plays a role in motile ciliogenesis. May help to recruit STK36 to the cilium or apical surface of the cell to initiate subsequent steps of construction of the central pair apparatus of motile cilia (By similarity) .

Type

Protein

Source

E.coli

Sequence

MAAQRGMPSSAVRVLEEALGMGLTAAGDARDTADAVAAEGAYYLEQVTITEASEDDYEYEEIPDDNFSIPEGEEDLAKAIQMAQEQATDTEILERKTVLPSKHAVPEVIEDFLCNFLIKMGMTRTLDCFQSEWYELIQKGVTELRTVGNVPDVYTQIMLLENENKNLKKDLKHYKQAAEYVIF

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

47.6 kDa

Protein Length

Recombinant

NCBI Gene Symbol

SPAG16

Protein Name

Sperm-associated antigen 16 protein

Gene Name URL

SPAG16

Nucleotide Accession Number

NM_001025436

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mycobacterium bovis Maltokinase (pep2)
MBS1078863-01 0.02 mg (E-Coli)

Recombinant Mycobacterium bovis Maltokinase (pep2)

Sign In for Pricing
View Details
Recombinant Mycobacterium bovis Maltokinase (pep2)
MBS1078863-02 0.02 mg (Yeast)

Recombinant Mycobacterium bovis Maltokinase (pep2)

Sign In for Pricing
View Details
Recombinant Mycobacterium bovis Maltokinase (pep2)
MBS1078863-03 0.1 mg (E-Coli)

Recombinant Mycobacterium bovis Maltokinase (pep2)

Sign In for Pricing
View Details
Recombinant Mycobacterium bovis Maltokinase (pep2)
MBS1078863-04 0.1 mg (Yeast)

Recombinant Mycobacterium bovis Maltokinase (pep2)

Sign In for Pricing
View Details
Recombinant Mycobacterium bovis Maltokinase (pep2)
MBS1078863-05 0.02 mg (Baculovirus)

Recombinant Mycobacterium bovis Maltokinase (pep2)

Sign In for Pricing
View Details
Recombinant Mycobacterium bovis Maltokinase (pep2)
MBS1078863-06 0.02 mg (Mammalian-Cell)

Recombinant Mycobacterium bovis Maltokinase (pep2)

Sign In for Pricing
View Details