What is the catalog number for Recombinant human Type-1 angiotensin II receptor?

The catalog number for Recombinant human Type-1 angiotensin II receptor is OPCA01197-20UG.

What sizes are available for Recombinant human Type-1 angiotensin II receptor?

Recombinant human Type-1 angiotensin II receptor is available in the following size(s): 20 µg.

Is Recombinant human Type-1 angiotensin II receptor in stock?

Recombinant human Type-1 angiotensin II receptor is currently made to order / not held in immediate stock. Contact us for lead time.

Recombinant human Type-1 angiotensin II receptor

Product Specifications

CAS Number

9000-83-3

Gene Name

Angiotensin II receptor type 1

Gene Aliases

AG2S; AGTR1B; Angiotensin II type-1 receptor; AT1; AT1AR; AT1B; AT1BR; AT1R; AT2R1; HAT1R; type-1 angiotensin II receptor; type-1B angiotensin II receptor.

Gene ID

185

Reactivity

Homo sapiens|Human

Target

Receptor for angiotensin II. Mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system.

Type

Protein

Source

Yeast

Sequence

LNPLFYGFLGKKFKRYFLQLLKYIPPKAKSHSNLSTKMSTLSYRPSDNVSSSTKKPAPCFEVE

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.