Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat C-C motif chemokine 6 protein (Ccl6), Active Protein

Recombinant Rat C-C motif chemokine 6 protein (Ccl6), Active Protein is a purified Active Recombinant Protein. Purity: >97% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Rat (Rattus norvegicus) . Target Name: C-C motif chemokine 6 protein (Ccl6) . Accession Number: Q68FP3; Ccl6. Expression Region: 22-115aa. Tag Info: Tag-Free. Theoretical MW: 10.4kda. Target Synonyms: Small-inducible cytokine A6 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Rat C-C motif chemokine 6 protein (Ccl6), Active Protein is a purified Active Recombinant Protein.

Accession Number

Q68FP3; Ccl6

Expression Region

22-115aa

Host

E. coli

Target

C-C motif chemokine 6 protein (Ccl6)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Immunology

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>97% by SDS-PAGE

Activity

Biologically Active

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

10.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Small-inducible cytokine A6

Species

Rat (Rattus norvegicus)

Protein Name

Active Recombinant Protein

AA Sequence

GLIQDTVKEDRPFNPTIIHQGFQDSSDCCFSYASQIPCSRFIYYFPTSGGCTKPGIIFVTRKRKRVCANPSDQRVQTCISTLKLGPRSGNSAIA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC100188932 Protein Vector (Rat) (pPB-C-His)
PV277902 500 ng

LOC100188932 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
HSF2 (Heat Shock Factor 2, HSF 2, Heat Shock Transcription Factor 2, HSTF 2) (MaxLight 490)
MBS6421530-01 0.1 mL

HSF2 (Heat Shock Factor 2, HSF 2, Heat Shock Transcription Factor 2, HSTF 2) (MaxLight 490)

Sign In for Pricing
View Details
HSF2 (Heat Shock Factor 2, HSF 2, Heat Shock Transcription Factor 2, HSTF 2) (MaxLight 490)
MBS6421530-02 5x 0.1 mL

HSF2 (Heat Shock Factor 2, HSF 2, Heat Shock Transcription Factor 2, HSTF 2) (MaxLight 490)

Sign In for Pricing
View Details
Canine Tissue factor pathway inhibitor ELISA Kit
MBS743620-01 48 Well

Canine Tissue factor pathway inhibitor ELISA Kit

Sign In for Pricing
View Details
Canine Tissue factor pathway inhibitor ELISA Kit
MBS743620-02 96 Well

Canine Tissue factor pathway inhibitor ELISA Kit

Sign In for Pricing
View Details
Canine Tissue factor pathway inhibitor ELISA Kit
MBS743620-03 5x 96 Well

Canine Tissue factor pathway inhibitor ELISA Kit

Sign In for Pricing
View Details