Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat C-C motif chemokine 6 protein (Ccl6), Active Protein

Recombinant Rat C-C motif chemokine 6 protein (Ccl6), Active Protein is a purified Active Recombinant Protein. Purity: >97% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Rat (Rattus norvegicus) . Target Name: C-C motif chemokine 6 protein (Ccl6) . Accession Number: Q68FP3; Ccl6. Expression Region: 22-115aa. Tag Info: Tag-Free. Theoretical MW: 10.4kda. Target Synonyms: Small-inducible cytokine A6 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Rat C-C motif chemokine 6 protein (Ccl6), Active Protein is a purified Active Recombinant Protein.

Accession Number

Q68FP3; Ccl6

Expression Region

22-115aa

Host

E. coli

Target

C-C motif chemokine 6 protein (Ccl6)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Immunology

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>97% by SDS-PAGE

Activity

Biologically Active

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

10.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Small-inducible cytokine A6

Species

Rat (Rattus norvegicus)

Protein Name

Active Recombinant Protein

AA Sequence

GLIQDTVKEDRPFNPTIIHQGFQDSSDCCFSYASQIPCSRFIYYFPTSGGCTKPGIIFVTRKRKRVCANPSDQRVQTCISTLKLGPRSGNSAIA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CA1 antibody
10R-1980 100 ul

CA1 antibody

Sign In for Pricing
View Details
Human INF2 knockout cell line
ABC-KH7382 1 Vial

Human INF2 knockout cell line

Sign In for Pricing
View Details
Sodium Deoxycholic Acid Solution, 1%, pH8.0
G0161 100 mL

Sodium Deoxycholic Acid Solution, 1%, pH8.0

Sign In for Pricing
View Details
CD2 (Erythrocyte receptor, LFA-2, LFA-3 receptor, Ly-37, Lymphocyte function antigen 2, Rosette receptor, SRBC, T-cell surface antigen CD2, T-cell surface antigen T11/Leu-5, T11) (BSA & Azide Free) (MaxLight 405) discontinued
168674-AF-ML405 100 µL

CD2 (Erythrocyte receptor, LFA-2, LFA-3 receptor, Ly-37, Lymphocyte function antigen 2, Rosette receptor, SRBC, T-cell surface antigen CD2, T-cell surface antigen T11/Leu-5, T11) (BSA & Azide Free) (MaxLight 405) discontinued

Sign In for Pricing
View Details
ZNF230 (Zinc Finger Protein 230, MGC8715, Ring Finger Protein 141, RNF141, ZFP26) (MaxLight 750) discontinued
135642-ML750 100 µL

ZNF230 (Zinc Finger Protein 230, MGC8715, Ring Finger Protein 141, RNF141, ZFP26) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Recombinant Human BSSP-4 (C-6His)
PHH1734-01 10 µg

Recombinant Human BSSP-4 (C-6His)

Sign In for Pricing
View Details