Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat C-C motif chemokine 6 protein (Ccl6), Active Protein

Recombinant Rat C-C motif chemokine 6 protein (Ccl6), Active Protein is a purified Active Recombinant Protein. Purity: >97% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Rat (Rattus norvegicus) . Target Name: C-C motif chemokine 6 protein (Ccl6) . Accession Number: Q68FP3; Ccl6. Expression Region: 22-115aa. Tag Info: Tag-Free. Theoretical MW: 10.4kda. Target Synonyms: Small-inducible cytokine A6 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Rat C-C motif chemokine 6 protein (Ccl6), Active Protein is a purified Active Recombinant Protein.

Accession Number

Q68FP3; Ccl6

Expression Region

22-115aa

Host

E. coli

Target

C-C motif chemokine 6 protein (Ccl6)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Immunology

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>97% by SDS-PAGE

Activity

Biologically Active

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

10.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Small-inducible cytokine A6

Species

Rat (Rattus norvegicus)

Protein Name

Active Recombinant Protein

AA Sequence

GLIQDTVKEDRPFNPTIIHQGFQDSSDCCFSYASQIPCSRFIYYFPTSGGCTKPGIIFVTRKRKRVCANPSDQRVQTCISTLKLGPRSGNSAIA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL35AP21-set siRNA/shRNA/RNAi Lentivector (Human)
41500091 4x 500 ng

RPL35AP21-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
Recombinant Human IL1RA / Interleukin-1 receptor antagonist, Animal Free & Carrier Free
C-CYP106-1mg 1 mg

Recombinant Human IL1RA / Interleukin-1 receptor antagonist, Animal Free & Carrier Free

Sign In for Pricing
View Details
Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) RTT106 Polyclonal Antibody
MBS7154546 Inquire

Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) RTT106 Polyclonal Antibody

Sign In for Pricing
View Details
Mouse MYRF siRNA
abx925262-01 15 nmol

Mouse MYRF siRNA

Sign In for Pricing
View Details
Mouse MYRF siRNA
abx925262-02 30 nmol

Mouse MYRF siRNA

Sign In for Pricing
View Details
CTBP2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3G4]
TA807903AM 100 µL

CTBP2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3G4]

Sign In for Pricing
View Details