Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat C-C motif chemokine 6 protein (Ccl6), Active Protein

Recombinant Rat C-C motif chemokine 6 protein (Ccl6), Active Protein is a purified Active Recombinant Protein. Purity: >97% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Rat (Rattus norvegicus) . Target Name: C-C motif chemokine 6 protein (Ccl6) . Accession Number: Q68FP3; Ccl6. Expression Region: 22-115aa. Tag Info: Tag-Free. Theoretical MW: 10.4kda. Target Synonyms: Small-inducible cytokine A6 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Rat C-C motif chemokine 6 protein (Ccl6), Active Protein is a purified Active Recombinant Protein.

Accession Number

Q68FP3; Ccl6

Expression Region

22-115aa

Host

E. coli

Target

C-C motif chemokine 6 protein (Ccl6)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Immunology

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>97% by SDS-PAGE

Activity

Biologically Active

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

10.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Small-inducible cytokine A6

Species

Rat (Rattus norvegicus)

Protein Name

Active Recombinant Protein

AA Sequence

GLIQDTVKEDRPFNPTIIHQGFQDSSDCCFSYASQIPCSRFIYYFPTSGGCTKPGIIFVTRKRKRVCANPSDQRVQTCISTLKLGPRSGNSAIA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATP1A3 Recombinant Antibody, AbBy Fluor™ 488 Conjugated
bsm-62146R-BF488 100 µL

ATP1A3 Recombinant Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
Human ZNF449 knockout cell line
ABC-KH17554 1 Vial

Human ZNF449 knockout cell line

Sign In for Pricing
View Details
Zinc finger protein 668 (ZNF668) (NM_001172669) Human Tagged Lenti ORF Clone
RC230384L2 10 µg

Zinc finger protein 668 (ZNF668) (NM_001172669) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Alphameprodine Hydrochloride
TRC-M224950-10MG 10 mg

Alphameprodine Hydrochloride

Sign In for Pricing
View Details
GENLISA™ Human Frizzled Homolog 10 (FZD10) ELISA
KBH2365 1x 96 Well

GENLISA™ Human Frizzled Homolog 10 (FZD10) ELISA

Sign In for Pricing
View Details
CFHL2 (CFHR2) (NM_005666) Human Tagged Lenti ORF Clone
RC204689L4 10 µg

CFHL2 (CFHR2) (NM_005666) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details