Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat C-C motif chemokine 6 protein (Ccl6), Active Protein

Recombinant Rat C-C motif chemokine 6 protein (Ccl6), Active Protein is a purified Active Recombinant Protein. Purity: >97% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Rat (Rattus norvegicus) . Target Name: C-C motif chemokine 6 protein (Ccl6) . Accession Number: Q68FP3; Ccl6. Expression Region: 22-115aa. Tag Info: Tag-Free. Theoretical MW: 10.4kda. Target Synonyms: Small-inducible cytokine A6 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Rat C-C motif chemokine 6 protein (Ccl6), Active Protein is a purified Active Recombinant Protein.

Accession Number

Q68FP3; Ccl6

Expression Region

22-115aa

Host

E. coli

Target

C-C motif chemokine 6 protein (Ccl6)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Immunology

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>97% by SDS-PAGE

Activity

Biologically Active

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

10.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Small-inducible cytokine A6

Species

Rat (Rattus norvegicus)

Protein Name

Active Recombinant Protein

AA Sequence

GLIQDTVKEDRPFNPTIIHQGFQDSSDCCFSYASQIPCSRFIYYFPTSGGCTKPGIIFVTRKRKRVCANPSDQRVQTCISTLKLGPRSGNSAIA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ganoderic acid R
MF-0146336-01 25 mg

Ganoderic acid R

Sign In for Pricing
View Details
Ganoderic acid R
MF-0146336-02 50 mg

Ganoderic acid R

Sign In for Pricing
View Details
Ganoderic acid R
MF-0146336-03 100 mg

Ganoderic acid R

Sign In for Pricing
View Details
PLGF (Placental Growth Factor, Vascular Endothelial Growth Factor-related Protein) (APC)
MBS6493970-01 0.1 mL

PLGF (Placental Growth Factor, Vascular Endothelial Growth Factor-related Protein) (APC)

Sign In for Pricing
View Details
PLGF (Placental Growth Factor, Vascular Endothelial Growth Factor-related Protein) (APC)
MBS6493970-02 5x 0.1 mL

PLGF (Placental Growth Factor, Vascular Endothelial Growth Factor-related Protein) (APC)

Sign In for Pricing
View Details
Rabbit Anti-CXB5/GJB5 Polyclonal Antibody
PAV1079 100 μL

Rabbit Anti-CXB5/GJB5 Polyclonal Antibody

Sign In for Pricing
View Details