Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat C-C motif chemokine 6 protein (Ccl6), Active Protein

Recombinant Rat C-C motif chemokine 6 protein (Ccl6), Active Protein is a purified Active Recombinant Protein. Purity: >97% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Rat (Rattus norvegicus) . Target Name: C-C motif chemokine 6 protein (Ccl6) . Accession Number: Q68FP3; Ccl6. Expression Region: 22-115aa. Tag Info: Tag-Free. Theoretical MW: 10.4kda. Target Synonyms: Small-inducible cytokine A6 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Rat C-C motif chemokine 6 protein (Ccl6), Active Protein is a purified Active Recombinant Protein.

Accession Number

Q68FP3; Ccl6

Expression Region

22-115aa

Host

E. coli

Target

C-C motif chemokine 6 protein (Ccl6)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Immunology

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>97% by SDS-PAGE

Activity

Biologically Active

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

10.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Small-inducible cytokine A6

Species

Rat (Rattus norvegicus)

Protein Name

Active Recombinant Protein

AA Sequence

GLIQDTVKEDRPFNPTIIHQGFQDSSDCCFSYASQIPCSRFIYYFPTSGGCTKPGIIFVTRKRKRVCANPSDQRVQTCISTLKLGPRSGNSAIA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

HCG2P1 CRISPR Knock Out 293T Cell Line (Human)
58590141 1x 10^6 Cells / 1.0 mL

HCG2P1 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
GPR171 3'UTR Luciferase Stable Cell Line
TU009245 1.0 mL

GPR171 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Lentiviral human SCN10A shRNA (UAS) - Lentiviral human SCN10A shRNA (UAS) (100)
GTR15137994 1 Vial

Lentiviral human SCN10A shRNA (UAS) - Lentiviral human SCN10A shRNA (UAS) (100)

Sign In for Pricing
View Details
ZFP37 sgRNA CRISPR Lentivector (Human) (Target 3)
K2673504 1.0 µg DNA

ZFP37 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Anti-Human GCHFR Polyclonal Antibody
PHD86601 100 μg

Anti-Human GCHFR Polyclonal Antibody

Sign In for Pricing
View Details
Chk2 Rabbit Monoclonal Antibody
E28G1551 100 µL

Chk2 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details