Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat C-C motif chemokine 6 protein (Ccl6), Active Protein

Recombinant Rat C-C motif chemokine 6 protein (Ccl6), Active Protein is a purified Active Recombinant Protein. Purity: >97% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Rat (Rattus norvegicus) . Target Name: C-C motif chemokine 6 protein (Ccl6) . Accession Number: Q68FP3; Ccl6. Expression Region: 22-115aa. Tag Info: Tag-Free. Theoretical MW: 10.4kda. Target Synonyms: Small-inducible cytokine A6 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Rat C-C motif chemokine 6 protein (Ccl6), Active Protein is a purified Active Recombinant Protein.

Accession Number

Q68FP3; Ccl6

Expression Region

22-115aa

Host

E. coli

Target

C-C motif chemokine 6 protein (Ccl6)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Immunology

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>97% by SDS-PAGE

Activity

Biologically Active

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

10.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Small-inducible cytokine A6

Species

Rat (Rattus norvegicus)

Protein Name

Active Recombinant Protein

AA Sequence

GLIQDTVKEDRPFNPTIIHQGFQDSSDCCFSYASQIPCSRFIYYFPTSGGCTKPGIIFVTRKRKRVCANPSDQRVQTCISTLKLGPRSGNSAIA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tagln (NM_031549) Rat Tagged ORF Clone
RR213687 10 µg

Tagln (NM_031549) Rat Tagged ORF Clone

Sign In for Pricing
View Details
Ox-LDL Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-8574R-BF680 100 µL

Ox-LDL Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
Recombinant Campylobacter Jejuni queA Protein (aa 1-342) (strain 81-176)
VAng-Ly2848-500gEcoli 500 µg (E. coli)

Recombinant Campylobacter Jejuni queA Protein (aa 1-342) (strain 81-176)

Sign In for Pricing
View Details
CTP synthase (CTPS1) (NM_001905) Human Tagged Lenti ORF Clone
RC202434L1 10 µg

CTP synthase (CTPS1) (NM_001905) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Rabbit Polyclonal BCMO1 Antibody
NBP3-10784-100ul 100 µL

Rabbit Polyclonal BCMO1 Antibody

Sign In for Pricing
View Details
Ergosteryl Palmitate
TRC-E929810-100MG 100 mg

Ergosteryl Palmitate

Sign In for Pricing
View Details