What is the catalog number for Recombinant rat GTPase HRas protein?

The catalog number for Recombinant rat GTPase HRas protein is OPCA01077-20UG.

What sizes are available for Recombinant rat GTPase HRas protein?

Recombinant rat GTPase HRas protein is available in the following size(s): 20 µg.

Is Recombinant rat GTPase HRas protein in stock?

Recombinant rat GTPase HRas protein is currently made to order / not held in immediate stock. Contact us for lead time.

Recombinant rat GTPase HRas protein

Product Specifications

CAS Number

9000-83-3

Gene Name

HRas proto-oncogene, GTPase

Gene Aliases

C-H-ras; GTPase HRas; Harvey ras1 protein; Harvey rat sarcoma viral (v-Ha-ras) oncogene homolog; Harvey rat sarcoma virus oncogene; H-Ras-1; HRAS1; p21ras; transforming protein p21.

Gene ID

293621

Reactivity

Rat|Rattus norvegicus

Target

Ras proteins bind GDP/GTP and possess intrinsic GTPase activity.

Type

Protein

Source

E.coli

Sequence

TEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPGCMSCKC

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.