Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD200R4, Mouse (HEK293, His)

The CD200R4 protein significantly contributes to TYROBP receptor recruitment or surface expression, suggesting its role in immune regulation or signaling processes. Molecular interactions with TYROBP underscore the function of CD200R4, which may influence downstream cellular responses and mediate TYROBP-related signaling events. CD200R4 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD200R4 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD200R4 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd200r4-protein-mouse-hek293-his.html

Purity

95.00

Smiles

TDENQTIQNDSSSSLTQVNTTMSVQMDKKALLCCFSSPLINAVLITWIIKHRHLPSCTIAYNLDKKTNETSCLGRNITWASTPDHSPELQISAVALQHEGTYTCEIVTPEGNLEKVYDLQVLVPPEVTYFPGKNRTAVCEAMAGKPAAQISWTPDGDCVTKSESHSNGTVTVRSTCHWEQNNVSVVSCLVSHSTGNQSLSIELSQGTMTTPRSLLT

Molecular Formula

239849 (Gene_ID) Q6XJV4 (T26-T241) (Accession)

Molecular Weight

The protein migrates as an approximately 40-75 kDa band under reducing SDS-PAGE due to glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Urotensin II-Related Peptide (human, mouse, rat)
4043726.0005 5 mg

Urotensin II-Related Peptide (human, mouse, rat)

Sign In for Pricing
View Details
MAP2, CT (Microtubule Associated Protein 2, MAP-2) (APC) discontinued
M2350-02C-APC 200 µL

MAP2, CT (Microtubule Associated Protein 2, MAP-2) (APC) discontinued

Sign In for Pricing
View Details
Recombinant Probable protein-export membrane protein SecG (secG)
orb2936745-01 20 µg

Recombinant Probable protein-export membrane protein SecG (secG)

Sign In for Pricing
View Details
Recombinant Probable protein-export membrane protein SecG (secG)
orb2936745-02 100 µg

Recombinant Probable protein-export membrane protein SecG (secG)

Sign In for Pricing
View Details
Sulfametoxydiazine (SMD) ELISA Kit
abx364903 96 Tests

Sulfametoxydiazine (SMD) ELISA Kit

Sign In for Pricing
View Details
Hybrid Grid Box; holds both clipped and unclipped grids
M-CEM-NS-HGB-NL-12 12 Units

Hybrid Grid Box; holds both clipped and unclipped grids

Sign In for Pricing
View Details