Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Probable protein-export membrane protein SecG (secG)

This Recombinant Probable protein-export membrane protein SecG (secG) spans the amino acid sequence from region 1-77.

Product Specifications

Product Name Alternative

Probable protein-export membrane protein SecG

UniProt

P66792

Expression Region

1-77

Origin

Mycobacterium bovis

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MELALQITLIVTSVLVVLLVLLHRAKGGGLSTLFGGGVQSSLSGSTVVEKNLDRLTLFVT GIWLVSIIGVALLIKYR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PSMB9 Antibody (C-term) [APR06094G]
APR06094G-01 50 µL

PSMB9 Antibody (C-term) [APR06094G]

Sign In for Pricing
View Details
PSMB9 Antibody (C-term) [APR06094G]
APR06094G-02 100 µL

PSMB9 Antibody (C-term) [APR06094G]

Sign In for Pricing
View Details
PSMB9 Antibody (C-term) [APR06094G]
APR06094G-03 200 µL

PSMB9 Antibody (C-term) [APR06094G]

Sign In for Pricing
View Details
PSMB9 Antibody (C-term) [APR06094G]
APR06094G-04 400 µL

PSMB9 Antibody (C-term) [APR06094G]

Sign In for Pricing
View Details
Hamster Casein Kappa ELISA Kit
MBS052138-01 48 Well

Hamster Casein Kappa ELISA Kit

Sign In for Pricing
View Details
Hamster Casein Kappa ELISA Kit
MBS052138-02 96 Well

Hamster Casein Kappa ELISA Kit

Sign In for Pricing
View Details