Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Probable protein-export membrane protein SecG (secG)

This Recombinant Probable protein-export membrane protein SecG (secG) spans the amino acid sequence from region 1-77.

Product Specifications

Product Name Alternative

Probable protein-export membrane protein SecG

UniProt

P66792

Expression Region

1-77

Origin

Mycobacterium bovis

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MELALQITLIVTSVLVVLLVLLHRAKGGGLSTLFGGGVQSSLSGSTVVEKNLDRLTLFVT GIWLVSIIGVALLIKYR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-BAP1 (Ser369) Antibody
MBS9610787-01 0.05 mL

Phospho-BAP1 (Ser369) Antibody

Sign In for Pricing
View Details
Phospho-BAP1 (Ser369) Antibody
MBS9610787-02 0.1 mL

Phospho-BAP1 (Ser369) Antibody

Sign In for Pricing
View Details
Phospho-BAP1 (Ser369) Antibody
MBS9610787-03 0.2 mL

Phospho-BAP1 (Ser369) Antibody

Sign In for Pricing
View Details
Phospho-BAP1 (Ser369) Antibody
MBS9610787-04 5x 0.2 mL

Phospho-BAP1 (Ser369) Antibody

Sign In for Pricing
View Details
Chicken Polyclonal TMPRSS11A Antibody [Alexa Fluor 405]
NBP2-41140AF405 0.1 mL

Chicken Polyclonal TMPRSS11A Antibody [Alexa Fluor 405]

Sign In for Pricing
View Details
GFP hsa-mir-190b AAV miRNA Vector
Amh1023200 500 ng

GFP hsa-mir-190b AAV miRNA Vector

Sign In for Pricing
View Details