Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HIST1H2BM, Mouse (His)

The HIST1H2BM protein is a key part of the nucleosome, which compacts DNA into chromatin. HIST1H2BM Protein, Mouse (His) is the recombinant mouse-derived HIST1H2BM protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

HIST1H2BM Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hist1h2bm-protein-mouse-his.html

Smiles

PEPTKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK

Molecular Formula

319186 (Gene_ID) P10854 (P2-K126) (Accession)

Molecular Weight

Approximately 17.8 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TNNC1 Rabbit Polyclonal Antibody
HA500407 100 µL

TNNC1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SLC15A1 Human Gene Knockout Kit (CRISPR)
KN222922 1 Kit

SLC15A1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Y14 (RBM8A) (NM_005105) Human Recombinant Protein
TP309770M 100 µg

Y14 (RBM8A) (NM_005105) Human Recombinant Protein

Sign In for Pricing
View Details
CYC1 (NM_001916) Human Over-expression Lysate
LC400709 20 µg

CYC1 (NM_001916) Human Over-expression Lysate

Sign In for Pricing
View Details
GAPDH Monoclonal Antibody
AN005280L-01 25 µL

GAPDH Monoclonal Antibody

Sign In for Pricing
View Details
GAPDH Monoclonal Antibody
AN005280L-02 100 µL

GAPDH Monoclonal Antibody

Sign In for Pricing
View Details