Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Fibroblast growth factor 2 (FGF2)

Product Specifications

Product Name Alternative

Basic fibroblast growth factor (bFGF) (Heparin-binding growth factor 2) (HBGF-2) (FGFB)

Abbreviation

Recombinant Human FGF2 protein

Gene Name

FGF2

UniProt

P09038

Expression Region

143-288aa

Organism

Homo sapiens (Human)

Target Sequence

PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Signal Transduction

Relevance

Acts as a ligand for FGFR1, FGFR2, FGFR3 and FGFR4. Also acts as an integrin ligand which is required for FGF2 signaling. Binds to integrin ITGAV:ITGB3. Plays an important role in the regulation of cell survival, cell division, cell differentiation and cell migration. Functions as a potent mitogen in vitro (PubMed:3732516, PubMed:3964259) . Can induce angiogenesis (PubMed:23469107, PubMed:28302677) .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration. Functions as potent mitogen in vitro. Can induce angiogenesis

Molecular Weight

17.9 kDa

References & Citations

"Basic fibroblast growth factor gene expression." Florkiewicz R.Z., Shibata F., Barankiewicz T., Baird A., Gonzalez A.M., Florkiewicz E., Shah N. Ann. N. Y. Acad. Sci. 638:109-126 (1991)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KRBOX1 Double Nickase Plasmid (h2)
sc-418873-NIC-2 20 µg

KRBOX1 Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
Recombinant Streptococcus equi subsp. equi Energy-coupling factor transporter transmembrane protein EcfT (ecfT)
orb2916634-01 20 µg

Recombinant Streptococcus equi subsp. equi Energy-coupling factor transporter transmembrane protein EcfT (ecfT)

Sign In for Pricing
View Details
Recombinant Streptococcus equi subsp. equi Energy-coupling factor transporter transmembrane protein EcfT (ecfT)
orb2916634-02 100 µg

Recombinant Streptococcus equi subsp. equi Energy-coupling factor transporter transmembrane protein EcfT (ecfT)

Sign In for Pricing
View Details
ORC5L Protein Vector (Human) (pPB-N-His)
PV029594 500 ng

ORC5L Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Rabbit TATA Box Binding Protein Associated Factor 1 ELISA kit
GTR10442323 96 Well

Rabbit TATA Box Binding Protein Associated Factor 1 ELISA kit

Sign In for Pricing
View Details
Myoglobin (MB) Human Over-expression Lysate
orb1355437 100 µg

Myoglobin (MB) Human Over-expression Lysate

Sign In for Pricing
View Details