Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Streptococcus equi subsp. equi Energy-coupling factor transporter transmembrane protein EcfT (ecfT)

This Recombinant Streptococcus equi subsp. equi Energy-coupling factor transporter transmembrane protein EcfT (ecfT) spans the amino acid sequence from region 1-269.

Product Specifications

Product Name Alternative

Energy-coupling factor transporter transmembrane protein EcfT, ECF transporter T component EcfT

UniProt

C0MBF3

Expression Region

1-269

Origin

Streptococcus equi subsp. equi (strain 4047)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDKLILGRYIPGNSIIHRLDPRSKLLAMIIYIIIIFWANNVVTNLLLLAFTLLLIFLSQI KWSFFFNGVKPMIGIILFTTLFQVFFTQGGSVLFQLGIIKITSLGLSQAILIFMRFVLII FFSTLLTLTTTPLSLSDAVEALLKPLVRFKVPAHEIGLMLSLSLRFVPTLMDDTTRIMNA QKARGVDFGEGNLIQKVKSIIPILIPLFASSFKRADALAIAMEARGYQGGDSRTKYRLLS WQLKDTLAIILVVILGIFLFCLKSPSRLT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mmu-miR-92a-3p miRNA Agomir
CMN0125-01 5 nmol

Mmu-miR-92a-3p miRNA Agomir

Sign In for Pricing
View Details
Mmu-miR-92a-3p miRNA Agomir
CMN0125-02 10 nmol

Mmu-miR-92a-3p miRNA Agomir

Sign In for Pricing
View Details
Mmu-miR-92a-3p miRNA Agomir
CMN0125-03 20 nmol

Mmu-miR-92a-3p miRNA Agomir

Sign In for Pricing
View Details
Pear1 3'UTR Lenti-reporter-Luc Vector
36366084 1.0 µg

Pear1 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Mouse Monoclonal PON1 Antibody (OTI2D4) [DyLight 488]
NBP2-73526G 0.1 mL

Mouse Monoclonal PON1 Antibody (OTI2D4) [DyLight 488]

Sign In for Pricing
View Details
Rabbit Anti-GABPB2 antibody
SL13262R-01 50 µL

Rabbit Anti-GABPB2 antibody

Sign In for Pricing
View Details