Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Streptococcus equi subsp. equi Energy-coupling factor transporter transmembrane protein EcfT (ecfT)

This Recombinant Streptococcus equi subsp. equi Energy-coupling factor transporter transmembrane protein EcfT (ecfT) spans the amino acid sequence from region 1-269.

Product Specifications

Product Name Alternative

Energy-coupling factor transporter transmembrane protein EcfT, ECF transporter T component EcfT

UniProt

C0MBF3

Expression Region

1-269

Origin

Streptococcus equi subsp. equi (strain 4047)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDKLILGRYIPGNSIIHRLDPRSKLLAMIIYIIIIFWANNVVTNLLLLAFTLLLIFLSQI KWSFFFNGVKPMIGIILFTTLFQVFFTQGGSVLFQLGIIKITSLGLSQAILIFMRFVLII FFSTLLTLTTTPLSLSDAVEALLKPLVRFKVPAHEIGLMLSLSLRFVPTLMDDTTRIMNA QKARGVDFGEGNLIQKVKSIIPILIPLFASSFKRADALAIAMEARGYQGGDSRTKYRLLS WQLKDTLAIILVVILGIFLFCLKSPSRLT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Branched-Chain-Amino-Acid Aminotransferase, Mitochondrial (BCAT2) Protein
abx073802-01 2 µg

Human Branched-Chain-Amino-Acid Aminotransferase, Mitochondrial (BCAT2) Protein

Sign In for Pricing
View Details
Human Branched-Chain-Amino-Acid Aminotransferase, Mitochondrial (BCAT2) Protein
abx073802-02 10 µg

Human Branched-Chain-Amino-Acid Aminotransferase, Mitochondrial (BCAT2) Protein

Sign In for Pricing
View Details
Human Branched-Chain-Amino-Acid Aminotransferase, Mitochondrial (BCAT2) Protein
abx073802-03 1 mg

Human Branched-Chain-Amino-Acid Aminotransferase, Mitochondrial (BCAT2) Protein

Sign In for Pricing
View Details
DTYMK (B-8) : m-IgG Fc BP-HRP Bundle
sc-529513 1 Kit

DTYMK (B-8) : m-IgG Fc BP-HRP Bundle

Sign In for Pricing
View Details
Lentiviral human XPR1 shRNA (UAS) - Lentiviral human XPR1 shRNA (UAS, iRFP) (100)
GTR15080403 1 Vial

Lentiviral human XPR1 shRNA (UAS) - Lentiviral human XPR1 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
C21orf123 Protein Vector (Human) (pPM-C-His)
PV049864 500 ng

C21orf123 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details