Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human HemK methyltransferase family member 2 (N6AMT1)

Product Specifications

Product Name Alternative

M.HsaHemK2P N (6) -adenine-specific DNA methyltransferase 1

Abbreviation

Recombinant Human N6AMT1 protein

Gene Name

N6AMT1

UniProt

Q9Y5N5

Expression Region

1-186aa

Organism

Homo sapiens (Human)

Target Sequence

MAGENFATPFHGHVGRGAFSDVYEPAEDTFLLLNALEAAAAELAGVEICLEVGSGSGVVSAFLASMIGPQALYMCTDINPEAAACTLETARCNKVHIQPVITDLVGSHGIEAAWAGGKNGREVMDRFFPLVPDLLSPKGLFYLVTIKENNPEEILKIMKTKGLQGTTALSRQAGQETLSVLKFTKS

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Epigenetics and Nuclear Signaling

Relevance

Heterodimeric methyltransferase that catalyzes N5-methylation of ETF1 on 'Gln-185', using S-adenosyl L-methionine as methyl donor. ETF1 needs to be complexed to ERF3 in its GTP-bound form to be efficiently methylated. May play a role in the modulation of arsenic-induced toxicity. May be involved in the conversion of monomethylarsonous acid (3+) into the less toxic dimethylarsonic acid.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Heterodimeric methyltransferase that catalyzes N5-methylation of ETF1 on 'Gln-185', using S-adenosyl L-methionine as methyl donor. ETF1 needs to be complexed to ERF3 in its GTP-bound form to be efficiently methylated. May play a role in the modulation of arsenic-induced toxicity. May be involved in the conversion of monomethylarsonous acid (3+) into the less toxic dimethylarsonic acid.

Molecular Weight

46.8 kDa

References & Citations

"Identification of a novel putative eukaryotic DNA-methyltransferase." Reboul J., Misseri Y., Bonnerot C., Mogensen E., Lutfalla G. Submitted (MAR-1999)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Isoform 2

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nudt15 Rabbit Polyclonal Antibody
TA356746 100 µL

Nudt15 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Prpf4b sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
37765116 3x 1.0 µg

Prpf4b sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Delta-like 3/DLL3, Human (P.pastoris, His)
HY-P71852-01 5 µg

Delta-like 3/DLL3, Human (P.pastoris, His)

Sign In for Pricing
View Details
Delta-like 3/DLL3, Human (P.pastoris, His)
HY-P71852-02 10 µg

Delta-like 3/DLL3, Human (P.pastoris, His)

Sign In for Pricing
View Details
Delta-like 3/DLL3, Human (P.pastoris, His)
HY-P71852-03 50 µg

Delta-like 3/DLL3, Human (P.pastoris, His)

Sign In for Pricing
View Details
Recombinant Chlamydophila Trachomatis rplE Protein (aa 1-180) (strain 434/Bu / ATCC VR-902B)
VAng-Lsx7066-500gEcoli 500 µg (E. coli)

Recombinant Chlamydophila Trachomatis rplE Protein (aa 1-180) (strain 434/Bu / ATCC VR-902B)

Sign In for Pricing
View Details