Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Delta-like 3/DLL3, Human (P.pastoris, His)

Delta-like protein 3/DLL3 stands out as a key regulator of neurogenesis and cell differentiation. As an inhibitor of primary neurogenesis, DLL3 plays a crucial role in guiding neurons along specific differentiation pathways. Delta-like protein 3/DLL3 Protein, Human (P.pastoris, His) is the recombinant human-derived Delta-like protein 3/DLL3 protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Delta-like protein 3/DLL3 Protein, Human (P.pastoris, His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/delta-like-protein-3-dll3-protein-human-p-pastoris-his.html

Purity

90.00

Smiles

AGVFELQIHSFGPGPGPGAPRSPCSARLPCRLFFRVCLKPGLSEEAAESPCALGAALSARGPVYTEQPGAPAPDLPLPDGLLQVPFRDAWPGTFSFIIETWREELGDQIGGPAWSLLARVAGRRRLAAGGPWARDIQRAGAWELRFSYRARCEPPAVGTACTRLCRPRSAPSRCGPGLRPCAPLEDECEAPLVCRAGCSPEHGFCEQPGECRCLEGWTGPLCTVPVSTSSCLSPRGPSSATTGCLVPGPGPCDGNPCANGGSCSETPRSFECTCPRGFYGLRCEVSGVTCADGPCFNGGLCVGGADPDSAYICHCPPGFQGSNCEKRVDRCSLQPCRNGGLCLDLGHALRCRCRAGFAGPRCEHDLDDCAGRACANGGTCVEGGGAHRCSCALGFGGRDCRERADPCAARPCAHGGRCYAHFSGLVCACAPGYMGARCEFPVHPDGASALPAAPPGLRPGDPQRYL

Molecular Formula

10683 (Gene_ID) Q9NYJ7-1 (A27-L492) (Accession)

Molecular Weight

Approximately 56 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

K3-EDTA Tube
K3-1-N 100 PCS

K3-EDTA Tube

Sign In for Pricing
View Details
TRBV29OR9-2 sgRNA CRISPR Lentivector (Human) (Target 2)
K2456703 1.0 µg DNA

TRBV29OR9-2 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Mouse Monoclonal NCAM-1/CD56 Antibody (rNCAM1/8758) [DyLight 650]
NBP3-20807C 0.1 mL

Mouse Monoclonal NCAM-1/CD56 Antibody (rNCAM1/8758) [DyLight 650]

Sign In for Pricing
View Details
Recombinant Salmonella dublin (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase
MBS1166764-01 0.02 mg (E-Coli)

Recombinant Salmonella dublin (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase

Sign In for Pricing
View Details
Recombinant Salmonella dublin (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase
MBS1166764-02 0.1 mg (E-Coli)

Recombinant Salmonella dublin (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase

Sign In for Pricing
View Details
Recombinant Salmonella dublin (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase
MBS1166764-03 0.02 mg (Yeast)

Recombinant Salmonella dublin (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase

Sign In for Pricing
View Details