Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Delta-like 3/DLL3, Human (P.pastoris, His)

Delta-like protein 3/DLL3 stands out as a key regulator of neurogenesis and cell differentiation. As an inhibitor of primary neurogenesis, DLL3 plays a crucial role in guiding neurons along specific differentiation pathways. Delta-like protein 3/DLL3 Protein, Human (P.pastoris, His) is the recombinant human-derived Delta-like protein 3/DLL3 protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Delta-like protein 3/DLL3 Protein, Human (P.pastoris, His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/delta-like-protein-3-dll3-protein-human-p-pastoris-his.html

Purity

90.00

Smiles

AGVFELQIHSFGPGPGPGAPRSPCSARLPCRLFFRVCLKPGLSEEAAESPCALGAALSARGPVYTEQPGAPAPDLPLPDGLLQVPFRDAWPGTFSFIIETWREELGDQIGGPAWSLLARVAGRRRLAAGGPWARDIQRAGAWELRFSYRARCEPPAVGTACTRLCRPRSAPSRCGPGLRPCAPLEDECEAPLVCRAGCSPEHGFCEQPGECRCLEGWTGPLCTVPVSTSSCLSPRGPSSATTGCLVPGPGPCDGNPCANGGSCSETPRSFECTCPRGFYGLRCEVSGVTCADGPCFNGGLCVGGADPDSAYICHCPPGFQGSNCEKRVDRCSLQPCRNGGLCLDLGHALRCRCRAGFAGPRCEHDLDDCAGRACANGGTCVEGGGAHRCSCALGFGGRDCRERADPCAARPCAHGGRCYAHFSGLVCACAPGYMGARCEFPVHPDGASALPAAPPGLRPGDPQRYL

Molecular Formula

10683 (Gene_ID) Q9NYJ7-1 (A27-L492) (Accession)

Molecular Weight

Approximately 56 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Slc46a3 shRNA (UAS) - Lentiviral mouseSlc46a3 shRNA (UAS, GFP) (25)
GTR15262208 1 Vial

Lentiviral mouse Slc46a3 shRNA (UAS) - Lentiviral mouseSlc46a3 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Mouse Ephrin-A1 MAb (Clone 93036)
MAB2116 500 µg

Mouse Ephrin-A1 MAb (Clone 93036)

Sign In for Pricing
View Details
Human Immunoglobulin G3 (IgG3) Monoclonal AssayLite Antibody (APC Conjugate)
60145-05061 150 µg

Human Immunoglobulin G3 (IgG3) Monoclonal AssayLite Antibody (APC Conjugate)

Sign In for Pricing
View Details
DEC-205 CRISPR Activation Plasmid (m2)
sc-421500-ACT-2 20 µg

DEC-205 CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details
DNA-Binding Protein HU 1 (HUP1) Antibody
abx300241-01 20 µg

DNA-Binding Protein HU 1 (HUP1) Antibody

Sign In for Pricing
View Details
DNA-Binding Protein HU 1 (HUP1) Antibody
abx300241-02 50 µg

DNA-Binding Protein HU 1 (HUP1) Antibody

Sign In for Pricing
View Details