Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Delta-like 3/DLL3, Human (P.pastoris, His)

Delta-like protein 3/DLL3 stands out as a key regulator of neurogenesis and cell differentiation. As an inhibitor of primary neurogenesis, DLL3 plays a crucial role in guiding neurons along specific differentiation pathways. Delta-like protein 3/DLL3 Protein, Human (P.pastoris, His) is the recombinant human-derived Delta-like protein 3/DLL3 protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Delta-like protein 3/DLL3 Protein, Human (P.pastoris, His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/delta-like-protein-3-dll3-protein-human-p-pastoris-his.html

Purity

90.00

Smiles

AGVFELQIHSFGPGPGPGAPRSPCSARLPCRLFFRVCLKPGLSEEAAESPCALGAALSARGPVYTEQPGAPAPDLPLPDGLLQVPFRDAWPGTFSFIIETWREELGDQIGGPAWSLLARVAGRRRLAAGGPWARDIQRAGAWELRFSYRARCEPPAVGTACTRLCRPRSAPSRCGPGLRPCAPLEDECEAPLVCRAGCSPEHGFCEQPGECRCLEGWTGPLCTVPVSTSSCLSPRGPSSATTGCLVPGPGPCDGNPCANGGSCSETPRSFECTCPRGFYGLRCEVSGVTCADGPCFNGGLCVGGADPDSAYICHCPPGFQGSNCEKRVDRCSLQPCRNGGLCLDLGHALRCRCRAGFAGPRCEHDLDDCAGRACANGGTCVEGGGAHRCSCALGFGGRDCRERADPCAARPCAHGGRCYAHFSGLVCACAPGYMGARCEFPVHPDGASALPAAPPGLRPGDPQRYL

Molecular Formula

10683 (Gene_ID) Q9NYJ7-1 (A27-L492) (Accession)

Molecular Weight

Approximately 56 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TBR1 (NM_006593) Human Untagged Clone
SC115971 10 µg

TBR1 (NM_006593) Human Untagged Clone

Sign In for Pricing
View Details
CYFIP1 Protein Vector (Mouse) (pPM-C-HA)
PV169340 500 ng

CYFIP1 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Dystrobrevin alpha (DTNA) Mouse Monoclonal Antibody [Clone ID: OTI1B2]
CF502184 100 µg

Dystrobrevin alpha (DTNA) Mouse Monoclonal Antibody [Clone ID: OTI1B2]

Sign In for Pricing
View Details
NACA1 Overexpression Lysate (Native) - (Dry Ice)
NBP2-11415 0.1 mg

NACA1 Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details
Rabbit Monoclonal CD7 Antibody (CD7/3868R) [Janelia Fluor 669]
NBP3-24056JF669 0.1 mL

Rabbit Monoclonal CD7 Antibody (CD7/3868R) [Janelia Fluor 669]

Sign In for Pricing
View Details
YAP1 (Yes-Associated Protein 1, 65kD, YAP, YAP2, YAP65, YKI) (Biotin)
MBS6171087-01 0.1 mL

YAP1 (Yes-Associated Protein 1, 65kD, YAP, YAP2, YAP65, YKI) (Biotin)

Sign In for Pricing
View Details