Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Delta-like 3/DLL3, Human (P.pastoris, His)

Delta-like protein 3/DLL3 stands out as a key regulator of neurogenesis and cell differentiation. As an inhibitor of primary neurogenesis, DLL3 plays a crucial role in guiding neurons along specific differentiation pathways. Delta-like protein 3/DLL3 Protein, Human (P.pastoris, His) is the recombinant human-derived Delta-like protein 3/DLL3 protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Delta-like protein 3/DLL3 Protein, Human (P.pastoris, His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/delta-like-protein-3-dll3-protein-human-p-pastoris-his.html

Purity

90.00

Smiles

AGVFELQIHSFGPGPGPGAPRSPCSARLPCRLFFRVCLKPGLSEEAAESPCALGAALSARGPVYTEQPGAPAPDLPLPDGLLQVPFRDAWPGTFSFIIETWREELGDQIGGPAWSLLARVAGRRRLAAGGPWARDIQRAGAWELRFSYRARCEPPAVGTACTRLCRPRSAPSRCGPGLRPCAPLEDECEAPLVCRAGCSPEHGFCEQPGECRCLEGWTGPLCTVPVSTSSCLSPRGPSSATTGCLVPGPGPCDGNPCANGGSCSETPRSFECTCPRGFYGLRCEVSGVTCADGPCFNGGLCVGGADPDSAYICHCPPGFQGSNCEKRVDRCSLQPCRNGGLCLDLGHALRCRCRAGFAGPRCEHDLDDCAGRACANGGTCVEGGGAHRCSCALGFGGRDCRERADPCAARPCAHGGRCYAHFSGLVCACAPGYMGARCEFPVHPDGASALPAAPPGLRPGDPQRYL

Molecular Formula

10683 (Gene_ID) Q9NYJ7-1 (A27-L492) (Accession)

Molecular Weight

Approximately 56 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tppp3 AAV siRNA Pooled Vector
47386166 1.0 µg

Tppp3 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Human IGFBP-7 Antibody Pair Set
MBS2577569-01 1 Pair

Human IGFBP-7 Antibody Pair Set

Sign In for Pricing
View Details
Human IGFBP-7 Antibody Pair Set
MBS2577569-02 5x 1 Pair

Human IGFBP-7 Antibody Pair Set

Sign In for Pricing
View Details
MIR5692A1 Recombinant Protein (Human)
RP074673 100 µg

MIR5692A1 Recombinant Protein (Human)

Sign In for Pricing
View Details
Porcine Aldo-Keto Reductase Family 1 Member C4 (AKR1C4) ELISA Kit
MBS9388813-01 48 Well

Porcine Aldo-Keto Reductase Family 1 Member C4 (AKR1C4) ELISA Kit

Sign In for Pricing
View Details
Porcine Aldo-Keto Reductase Family 1 Member C4 (AKR1C4) ELISA Kit
MBS9388813-02 96 Well

Porcine Aldo-Keto Reductase Family 1 Member C4 (AKR1C4) ELISA Kit

Sign In for Pricing
View Details