Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Delta-like 3/DLL3, Human (P.pastoris, His)

Delta-like protein 3/DLL3 stands out as a key regulator of neurogenesis and cell differentiation. As an inhibitor of primary neurogenesis, DLL3 plays a crucial role in guiding neurons along specific differentiation pathways. Delta-like protein 3/DLL3 Protein, Human (P.pastoris, His) is the recombinant human-derived Delta-like protein 3/DLL3 protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Delta-like protein 3/DLL3 Protein, Human (P.pastoris, His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/delta-like-protein-3-dll3-protein-human-p-pastoris-his.html

Purity

90.00

Smiles

AGVFELQIHSFGPGPGPGAPRSPCSARLPCRLFFRVCLKPGLSEEAAESPCALGAALSARGPVYTEQPGAPAPDLPLPDGLLQVPFRDAWPGTFSFIIETWREELGDQIGGPAWSLLARVAGRRRLAAGGPWARDIQRAGAWELRFSYRARCEPPAVGTACTRLCRPRSAPSRCGPGLRPCAPLEDECEAPLVCRAGCSPEHGFCEQPGECRCLEGWTGPLCTVPVSTSSCLSPRGPSSATTGCLVPGPGPCDGNPCANGGSCSETPRSFECTCPRGFYGLRCEVSGVTCADGPCFNGGLCVGGADPDSAYICHCPPGFQGSNCEKRVDRCSLQPCRNGGLCLDLGHALRCRCRAGFAGPRCEHDLDDCAGRACANGGTCVEGGGAHRCSCALGFGGRDCRERADPCAARPCAHGGRCYAHFSGLVCACAPGYMGARCEFPVHPDGASALPAAPPGLRPGDPQRYL

Molecular Formula

10683 (Gene_ID) Q9NYJ7-1 (A27-L492) (Accession)

Molecular Weight

Approximately 56 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sphingosine Kinase 2 (SPHK2) Antibody
abx006390-01 20 µL

Sphingosine Kinase 2 (SPHK2) Antibody

Sign In for Pricing
View Details
Sphingosine Kinase 2 (SPHK2) Antibody
abx006390-02 100 µL

Sphingosine Kinase 2 (SPHK2) Antibody

Sign In for Pricing
View Details
Sphingosine Kinase 2 (SPHK2) Antibody
abx006390-03 2x 100 µL

Sphingosine Kinase 2 (SPHK2) Antibody

Sign In for Pricing
View Details
Human Tissue Factor (TF) CLIA Kit
MBS2001065-01 24 Strip Well

Human Tissue Factor (TF) CLIA Kit

Sign In for Pricing
View Details
Human Tissue Factor (TF) CLIA Kit
MBS2001065-02 48 Well

Human Tissue Factor (TF) CLIA Kit

Sign In for Pricing
View Details
Human Tissue Factor (TF) CLIA Kit
MBS2001065-03 96 Well

Human Tissue Factor (TF) CLIA Kit

Sign In for Pricing
View Details