Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Delta-like 3/DLL3, Human (P.pastoris, His)

Delta-like protein 3/DLL3 stands out as a key regulator of neurogenesis and cell differentiation. As an inhibitor of primary neurogenesis, DLL3 plays a crucial role in guiding neurons along specific differentiation pathways. Delta-like protein 3/DLL3 Protein, Human (P.pastoris, His) is the recombinant human-derived Delta-like protein 3/DLL3 protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Delta-like protein 3/DLL3 Protein, Human (P.pastoris, His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/delta-like-protein-3-dll3-protein-human-p-pastoris-his.html

Purity

90.00

Smiles

AGVFELQIHSFGPGPGPGAPRSPCSARLPCRLFFRVCLKPGLSEEAAESPCALGAALSARGPVYTEQPGAPAPDLPLPDGLLQVPFRDAWPGTFSFIIETWREELGDQIGGPAWSLLARVAGRRRLAAGGPWARDIQRAGAWELRFSYRARCEPPAVGTACTRLCRPRSAPSRCGPGLRPCAPLEDECEAPLVCRAGCSPEHGFCEQPGECRCLEGWTGPLCTVPVSTSSCLSPRGPSSATTGCLVPGPGPCDGNPCANGGSCSETPRSFECTCPRGFYGLRCEVSGVTCADGPCFNGGLCVGGADPDSAYICHCPPGFQGSNCEKRVDRCSLQPCRNGGLCLDLGHALRCRCRAGFAGPRCEHDLDDCAGRACANGGTCVEGGGAHRCSCALGFGGRDCRERADPCAARPCAHGGRCYAHFSGLVCACAPGYMGARCEFPVHPDGASALPAAPPGLRPGDPQRYL

Molecular Formula

10683 (Gene_ID) Q9NYJ7-1 (A27-L492) (Accession)

Molecular Weight

Approximately 56 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Hepatoma Carcinoma Cell Line-CBRH7919
CC7F143 1x 10^6 Cells/Vial

Rat Hepatoma Carcinoma Cell Line-CBRH7919

Sign In for Pricing
View Details
MLH1 Blocking Peptide
CBP1742-01 1 mg

MLH1 Blocking Peptide

Sign In for Pricing
View Details
MLH1 Blocking Peptide
CBP1742-02 5 mg

MLH1 Blocking Peptide

Sign In for Pricing
View Details
Larixol
MBS5822313 Inquire

Larixol

Sign In for Pricing
View Details
POLE2 3'UTR Luciferase Stable Cell Line
TU018402 1.0 mL

POLE2 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Mouse Monoclonal Antibody to ABL1
MAB-606020244 0.1ml

Mouse Monoclonal Antibody to ABL1

Sign In for Pricing
View Details