Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Delta-like 3/DLL3, Human (P.pastoris, His)

Delta-like protein 3/DLL3 stands out as a key regulator of neurogenesis and cell differentiation. As an inhibitor of primary neurogenesis, DLL3 plays a crucial role in guiding neurons along specific differentiation pathways. Delta-like protein 3/DLL3 Protein, Human (P.pastoris, His) is the recombinant human-derived Delta-like protein 3/DLL3 protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Delta-like protein 3/DLL3 Protein, Human (P.pastoris, His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/delta-like-protein-3-dll3-protein-human-p-pastoris-his.html

Purity

90.00

Smiles

AGVFELQIHSFGPGPGPGAPRSPCSARLPCRLFFRVCLKPGLSEEAAESPCALGAALSARGPVYTEQPGAPAPDLPLPDGLLQVPFRDAWPGTFSFIIETWREELGDQIGGPAWSLLARVAGRRRLAAGGPWARDIQRAGAWELRFSYRARCEPPAVGTACTRLCRPRSAPSRCGPGLRPCAPLEDECEAPLVCRAGCSPEHGFCEQPGECRCLEGWTGPLCTVPVSTSSCLSPRGPSSATTGCLVPGPGPCDGNPCANGGSCSETPRSFECTCPRGFYGLRCEVSGVTCADGPCFNGGLCVGGADPDSAYICHCPPGFQGSNCEKRVDRCSLQPCRNGGLCLDLGHALRCRCRAGFAGPRCEHDLDDCAGRACANGGTCVEGGGAHRCSCALGFGGRDCRERADPCAARPCAHGGRCYAHFSGLVCACAPGYMGARCEFPVHPDGASALPAAPPGLRPGDPQRYL

Molecular Formula

10683 (Gene_ID) Q9NYJ7-1 (A27-L492) (Accession)

Molecular Weight

Approximately 56 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

DNase/RNase-Free Water (4 mL)
W1001-4 4 mL

DNase/RNase-Free Water (4 mL)

Sign In for Pricing
View Details
MRP-L14 Polyclonal Antibody
UB-GEN-3891 100 µL

MRP-L14 Polyclonal Antibody

Sign In for Pricing
View Details
ABHD14A Blocking Peptide
MBS8237069-01 1 mg

ABHD14A Blocking Peptide

Sign In for Pricing
View Details
ABHD14A Blocking Peptide
MBS8237069-02 5 mg

ABHD14A Blocking Peptide

Sign In for Pricing
View Details
ABHD14A Blocking Peptide
MBS8237069-03 5x 5 mg

ABHD14A Blocking Peptide

Sign In for Pricing
View Details
PLOD2 Mouse Monoclonal Antibody [Clone ID: OTI8A4]
TA803452 100 µL

PLOD2 Mouse Monoclonal Antibody [Clone ID: OTI8A4]

Sign In for Pricing
View Details