Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Delta-like 3/DLL3, Human (P.pastoris, His)

Delta-like protein 3/DLL3 stands out as a key regulator of neurogenesis and cell differentiation. As an inhibitor of primary neurogenesis, DLL3 plays a crucial role in guiding neurons along specific differentiation pathways. Delta-like protein 3/DLL3 Protein, Human (P.pastoris, His) is the recombinant human-derived Delta-like protein 3/DLL3 protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Delta-like protein 3/DLL3 Protein, Human (P.pastoris, His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/delta-like-protein-3-dll3-protein-human-p-pastoris-his.html

Purity

90.00

Smiles

AGVFELQIHSFGPGPGPGAPRSPCSARLPCRLFFRVCLKPGLSEEAAESPCALGAALSARGPVYTEQPGAPAPDLPLPDGLLQVPFRDAWPGTFSFIIETWREELGDQIGGPAWSLLARVAGRRRLAAGGPWARDIQRAGAWELRFSYRARCEPPAVGTACTRLCRPRSAPSRCGPGLRPCAPLEDECEAPLVCRAGCSPEHGFCEQPGECRCLEGWTGPLCTVPVSTSSCLSPRGPSSATTGCLVPGPGPCDGNPCANGGSCSETPRSFECTCPRGFYGLRCEVSGVTCADGPCFNGGLCVGGADPDSAYICHCPPGFQGSNCEKRVDRCSLQPCRNGGLCLDLGHALRCRCRAGFAGPRCEHDLDDCAGRACANGGTCVEGGGAHRCSCALGFGGRDCRERADPCAARPCAHGGRCYAHFSGLVCACAPGYMGARCEFPVHPDGASALPAAPPGLRPGDPQRYL

Molecular Formula

10683 (Gene_ID) Q9NYJ7-1 (A27-L492) (Accession)

Molecular Weight

Approximately 56 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human XPD (ERCC2) (NM_001130867) AAV Particle
RC225633A1V 250 µL

Human XPD (ERCC2) (NM_001130867) AAV Particle

Sign In for Pricing
View Details
Toll-Like Receptor 9 (TLR9) Porcine ELISA Kit
H6712 96 Tests

Toll-Like Receptor 9 (TLR9) Porcine ELISA Kit

Sign In for Pricing
View Details
GENLISA™ Human Prostaglandin FM (PGFM) ELISA
KBH3667 1x 96 Well

GENLISA™ Human Prostaglandin FM (PGFM) ELISA

Sign In for Pricing
View Details
Lentiviral mouse Kmt2b shRNA (UAS) - Lentiviral mouse Kmt2b shRNA (UAS, GFP) (100)
GTR15223485 1 Vial

Lentiviral mouse Kmt2b shRNA (UAS) - Lentiviral mouse Kmt2b shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
pOTB7-KIFC1 Plasmid
PVT24662 2 µg

pOTB7-KIFC1 Plasmid

Sign In for Pricing
View Details
1110034B05Rik ORF Vector (Mouse) (pORF)
ORF036601 1.0 µg DNA

1110034B05Rik ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details