Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Delta-like 3/DLL3, Human (P.pastoris, His)

Delta-like protein 3/DLL3 stands out as a key regulator of neurogenesis and cell differentiation. As an inhibitor of primary neurogenesis, DLL3 plays a crucial role in guiding neurons along specific differentiation pathways. Delta-like protein 3/DLL3 Protein, Human (P.pastoris, His) is the recombinant human-derived Delta-like protein 3/DLL3 protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Delta-like protein 3/DLL3 Protein, Human (P.pastoris, His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/delta-like-protein-3-dll3-protein-human-p-pastoris-his.html

Purity

90.00

Smiles

AGVFELQIHSFGPGPGPGAPRSPCSARLPCRLFFRVCLKPGLSEEAAESPCALGAALSARGPVYTEQPGAPAPDLPLPDGLLQVPFRDAWPGTFSFIIETWREELGDQIGGPAWSLLARVAGRRRLAAGGPWARDIQRAGAWELRFSYRARCEPPAVGTACTRLCRPRSAPSRCGPGLRPCAPLEDECEAPLVCRAGCSPEHGFCEQPGECRCLEGWTGPLCTVPVSTSSCLSPRGPSSATTGCLVPGPGPCDGNPCANGGSCSETPRSFECTCPRGFYGLRCEVSGVTCADGPCFNGGLCVGGADPDSAYICHCPPGFQGSNCEKRVDRCSLQPCRNGGLCLDLGHALRCRCRAGFAGPRCEHDLDDCAGRACANGGTCVEGGGAHRCSCALGFGGRDCRERADPCAARPCAHGGRCYAHFSGLVCACAPGYMGARCEFPVHPDGASALPAAPPGLRPGDPQRYL

Molecular Formula

10683 (Gene_ID) Q9NYJ7-1 (A27-L492) (Accession)

Molecular Weight

Approximately 56 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RT11 Polyclonal Antibody
UB-GEN-4845 100 µL

RT11 Polyclonal Antibody

Sign In for Pricing
View Details
One-step Universal Green RT-qPCR Kit
K1548-100 100 Reactions

One-step Universal Green RT-qPCR Kit

Sign In for Pricing
View Details
Trem1 sgRNA CRISPR Lentivector (Rat) (Target 2)
K6226603 1.0 µg DNA

Trem1 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Goat AT-rich interactive domain-containing protein 1B (ARID1B) ELISA Kit
MBS7203271-01 48 Well

Goat AT-rich interactive domain-containing protein 1B (ARID1B) ELISA Kit

Sign In for Pricing
View Details
Goat AT-rich interactive domain-containing protein 1B (ARID1B) ELISA Kit
MBS7203271-02 96 Well

Goat AT-rich interactive domain-containing protein 1B (ARID1B) ELISA Kit

Sign In for Pricing
View Details
Goat AT-rich interactive domain-containing protein 1B (ARID1B) ELISA Kit
MBS7203271-03 5x 96 Well

Goat AT-rich interactive domain-containing protein 1B (ARID1B) ELISA Kit

Sign In for Pricing
View Details