Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-1 beta, Rabbit

IL-1 beta is a potent proinflammatory cytokine expressed by monocytes, macrophages, and dendritic cells. IL-1 beta plays a key role in inflammation and immunologic reactions[1][2]. IL-1 beta Protein, Rabbit consists of 152 amino acids (A117-S268) and is expressed in E. coli.

Product Specifications

Product Name Alternative

IL-1 beta Protein, Rabbit, Rabbit, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-1-beta-protein-rabbit.html

Purity

98.00

Smiles

AVRSLHCRLQDAQQKSLVLSGTYELKALHLNAENLNQQVVFSMSFVQGEESNDKIPVALGLRGKNLYLSCVMKDDKPTLQLESVDPNRYPKKKMEKRFVFNKIEIKDKLEFESAQFPNWYISTSQTEYMPVFLGNNSGGQDLIDFSMEFVSS

Molecular Formula

100008990 (Gene_ID) P14628 (A117-S268) (Accession)

Molecular Weight

Approximately 19 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Jan Petrasek, et al. IL-1 receptor antagonist ameliorates inflammasome-dependent alcoholic steatohepatitis in mice. J Clin Invest. 2012 Oct;122 (10) :3476-89.|[2]Karina Zitta, et al. Interleukin-1beta regulates cell proliferation and activity of extracellular matrix remodelling enzymes in cultured primary pig heart cells. Biochem Biophys Res Commun. 2010 Sep 3;399 (4) :542-7.|[3]Kenichi Shimada, et al. Caspase-1 dependent IL-1β secretion is critical for host defense in a mouse model of Chlamydia pneumoniae lung infection. PLoS One. 2011;6 (6) :e21477.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

SP1 (NM_138473) Human Untagged Clone
SC101137 10 µg

SP1 (NM_138473) Human Untagged Clone

Ask
View Details
Mouse Monoclonal Inhibin alpha Antibody (INHA/4266) [Alexa Fluor 488]
NBP3-08780AF488 100 µL

Mouse Monoclonal Inhibin alpha Antibody (INHA/4266) [Alexa Fluor 488]

Ask
View Details
ZNF358 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
51475061 1.0 µg DNA

ZNF358 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Ask
View Details