Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD8A Peptide - middle region

CD8A Peptide - middle region

Product Specifications

Product Name Alternative

CD8, Leu2, MAL, p32

UniProt

P01732

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CD8A Rabbit Polyclonal Antibody (orb326279) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001139345

Preservative

Lyophilized powder

AA Sequence

RGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-Human LTB4R2 pAb
PA9124-01 50 μL

Rabbit Anti-Human LTB4R2 pAb

Sign In for Pricing
View Details
Rabbit Anti-Human LTB4R2 pAb
PA9124-02 100 μL

Rabbit Anti-Human LTB4R2 pAb

Sign In for Pricing
View Details
Mouse Gm10096 (NM_001102678) AAV Particle
MR212322A1V 250 µL

Mouse Gm10096 (NM_001102678) AAV Particle

Sign In for Pricing
View Details
CD276 Rabbit Polyclonal Antibody
orb2950420-01 50 µg

CD276 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD276 Rabbit Polyclonal Antibody
orb2950420-02 100 µg

CD276 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
RASSF3 shRNA (h) Lentiviral Particles
sc-62926-V 200 µL

RASSF3 shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details