IFN-alpha 2b/IFNA2, Human (P.pastoris)
IFN-alpha 2 (IFNA2), belongs to type I interferon family, is a protein secreted by cells infected by a virus and acting on other cells to inhibit viral infection[1]. IFN-alpha 2 increases the frequencies of cytotoxic CD8+ T cells and induces CD4+ T cell depletion[3]. IFN-alpha 2b/IFNA2 Protein, Human (P.pastoris) contains 165 a.a., is produced in yeast strain P. pastoris with tag free.
Product Specifications
Product Name Alternative
IFN-alpha 2b/IFNA2 Protein, Human (P.pastoris), Human, P. pastoris
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/ifn-alpha-2-protein-human-p-pastoris.html
Purity
98.0
Smiles
CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
Molecular Formula
3440 (Gene_ID) P01563 (C24-E188) (Accession)
Molecular Weight
Approximately 19.3 kDa
References & Citations
[1]Abraham S, et al. Gene therapy with plasmids encoding IFN-β or IFN-α14 confers long-term resistance to HIV-1 in humanized mice. Oncotarget. 2016 Nov 29;7 (48) :78412-78420.|[2]Zhang SY, et al. Inborn errors of interferon (IFN) -mediated immunity in humans: insights into the respective roles of IFN-alpha/beta, IFN-gamma, and IFN-lambda in host defense. Immunol Rev. 2008 Dec;226:29-40.
Shipping Conditions
Dry ice
Storage Conditions
Stored at -80°C for 1 year
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
RC226698L1V 200 µL
PNPLA4 (NM_001142389) Human Tagged ORF Clone Lentiviral Particle
Sign In for Pricing
View Details 
NBP2-12428AF350 0.1 mL
Rat Monoclonal H60 Antibody (RM0248-11G35) [Alexa Fluor 350]
Sign In for Pricing
View Details