Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IGFL1, Human (HEK293, hFc)

The IGFL1 protein is a possible ligand of the IGFLR1 receptor and mediates cellular responses through receptor binding. As a homodimer with disulfide bonds, the structural arrangement of IGFL1 suggests involvement in specific signaling events. IGFL1 Protein, Human (HEK293, hFc) is the recombinant human-derived IGFL1 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

IGFL1 Protein, Human (HEK293, hFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/igfl1-protein-human-hek293-hfc.html

Purity

96.00

Smiles

APVAPMTPYLMLCQPHKRCGDKFYDPLQHCCYDDAVVPLARTQTCGNCTFRVCFEQCCPWTFMVKLINQNCDSARTSDDRLCRSVS

Molecular Formula

374918 (Gene_ID) Q6UW32 (A25-S110) (Accession)

Molecular Weight

42 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IFluor® 633 Anti-human/ rabbit/ cat/ non-human primates/ ferret CD271 Antibody *NGFR5*
127100E1-AAT 500 Tests

IFluor® 633 Anti-human/ rabbit/ cat/ non-human primates/ ferret CD271 Antibody *NGFR5*

Sign In for Pricing
View Details
MIR633 Human qPCR Template Standard (MI0003648)
HK300544 200 Reactions

MIR633 Human qPCR Template Standard (MI0003648)

Sign In for Pricing
View Details
PAR4 antagonist 4
orb3134160-01 10 mg

PAR4 antagonist 4

Sign In for Pricing
View Details
PAR4 antagonist 4
orb3134160-02 50 mg

PAR4 antagonist 4

Sign In for Pricing
View Details
Pyrazolo[1,5-a]pyrimidine-3-carboxylic acid
FP16388-01 25 g

Pyrazolo[1,5-a]pyrimidine-3-carboxylic acid

Sign In for Pricing
View Details
Pyrazolo[1,5-a]pyrimidine-3-carboxylic acid
FP16388-02 50 g

Pyrazolo[1,5-a]pyrimidine-3-carboxylic acid

Sign In for Pricing
View Details