Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-33, Mouse (His)

IL-33 protein activates NF-kappa-B and MAPK signaling, inducing Th2 cell maturation and cytokine secretion. It activates mast cells, basophils, eosinophils, and natural killer cells and enhances macrophage polarization. Animal-Free IL-33 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-33 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-33 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-33-protein-mouse-his.html

Purity

98.0

Smiles

MSIQGTSLLTQSPASLSTYNDQSVSFVLENGCYVINVDDSGKDQEQDQVLLRYYESPCPASQSGDGVDGKKLMVNMSPIKDTDIWLHANDKDYSVELQRGDVSPPEQAFFVLHKKSSDFVSFECKNLPGTYIGVKDNQLALVEEKDESCNNIMFKLSKI

Molecular Formula

77125 (Gene_ID) Q8BVZ5 (S109-I266) (Accession)

Molecular Weight

Approximately 17-25 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Schizosaccharomyces pombe (strain 972/24843)(Fission yeast) SYB1 Polyclonal Antibody
MBS9004922 Inquire

Rabbit anti-Schizosaccharomyces pombe (strain 972/24843)(Fission yeast) SYB1 Polyclonal Antibody

Sign In for Pricing
View Details
Olfr1346 3'UTR GFP Stable Cell Line
TU164848 1.0 mL

Olfr1346 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Cyclic αvβ6
orb3180551-01 50 mg

Cyclic αvβ6

Sign In for Pricing
View Details
Cyclic αvβ6
orb3180551-02 10 mg

Cyclic αvβ6

Sign In for Pricing
View Details
PDDP
abx187834-01 1 g

PDDP

Sign In for Pricing
View Details
PDDP
abx187834-02 5 g

PDDP

Sign In for Pricing
View Details