Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTH1R, Human (HEK293, His)

PTH1R Protein, Human (HEK 293, His) is a recombinant PTH1R protein with a His-Flag. PTH1R plays an important role in skeletal development and homeostasis[1].

Product Specifications

Product Name Alternative

PTH1R Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pth1r-protein-human-hek-293-his.html

Purity

95.0

Smiles

YALVDADDVMTKEEQIFLLHRAQAQCEKRLKEVLQRPASIMESDKGWTSASTSGKPRKDKASGKLYPESEEDKEAPTGSRYRGRPCLPEWDHILCWPLGAPGEVVAVPCPDYIYDFNHKGHAYRRCDRNGSWELVPGHNRTWANYSECVKFLTNETREREVFDRLGM

Molecular Formula

5745 (Gene_ID) Q03431 (Y23-M189) (Accession)

Molecular Weight

25-35 kDa

References & Citations

[1]Bryce W Pickard, et al. Type 1 parathyroid hormone receptor (PTH1R) nuclear trafficking: association of PTH1R with importin alpha1 and beta. Endocrinology. 2006 Jul;147 (7) :3326-32.|[2]Xuekun Fu, et al. Al. Kindlin-2 regulates skeletal homeostasis by modulating PTH1R in mice. Signal Transduct Target Ther. 2020 Dec 26;5 (1) :297.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Polyclonal ANKRD1 Antibody
H00027063-B02P 0.05 mg

Mouse Polyclonal ANKRD1 Antibody

Sign In for Pricing
View Details
(1R,2S) -2-Amino-cyclooctanecarboxylic acid hydrochloride
OR308207 100 mg

(1R,2S) -2-Amino-cyclooctanecarboxylic acid hydrochloride

Sign In for Pricing
View Details
Fructose-isoleucine
orb3141857-01 10 mg

Fructose-isoleucine

Sign In for Pricing
View Details
Fructose-isoleucine
orb3141857-02 50 mg

Fructose-isoleucine

Sign In for Pricing
View Details
Rabbit Polyclonal CCDC66 Antibody [DyLight 755]
NBP3-05878IR 0.1 mL

Rabbit Polyclonal CCDC66 Antibody [DyLight 755]

Sign In for Pricing
View Details
Caspase-3 Rabbit pAb
E45R23365N 50 ul

Caspase-3 Rabbit pAb

Sign In for Pricing
View Details