Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Norrin (Ndp)

Recombinant Human Norrin (Ndp) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Ndp. Target Synonyms: Norrin (Norrie disease protein; X-linked exudative vitreoretinopathy 2 protein) . Accession Number: Q00604. Expression Region: 25~133aa. Tag Info: N-Terminal 10Xhis-Gst-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 47.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Norrin (Ndp) is a purified Recombinant Protein.

Accession Number

Q00604

Expression Region

25~133aa

Host

E. coli

Target

Ndp

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Gst-Tagged And C-Terminal Myc-Tagged

Field of Research

Neuroscience

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

47.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Norrin (Norrie disease protein; X-linked exudative vitreoretinopathy 2 protein)

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

KTDSSFIMDSDPRRCMRHHYVDSISHPLYKCSSKMVLLARCEGHCSQASRSEPLVSFSTVLKQPFRSSCHCCRPQTSKLKALRLRCSGGMRLTATYRYILSCHCEECNS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NOX4 Rabbit monoclonal antibody
BS41534-01 50 µL

NOX4 Rabbit monoclonal antibody

Sign In for Pricing
View Details
NOX4 Rabbit monoclonal antibody
BS41534-02 100 µL

NOX4 Rabbit monoclonal antibody

Sign In for Pricing
View Details
REEP3 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
38787065 1.0 µg DNA

REEP3 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
MYB (Transcriptional Activator Myb, V-myb Myeloblastosis Viral Oncogene Homolog (Avian) )
486358 100 µL

MYB (Transcriptional Activator Myb, V-myb Myeloblastosis Viral Oncogene Homolog (Avian) )

Sign In for Pricing
View Details
Sheep Toll Like Receptor 8 ELISA Kit
MBS037834-01 48 Well

Sheep Toll Like Receptor 8 ELISA Kit

Sign In for Pricing
View Details
Sheep Toll Like Receptor 8 ELISA Kit
MBS037834-02 96 Well

Sheep Toll Like Receptor 8 ELISA Kit

Sign In for Pricing
View Details