Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein CBFA2T1 (RUNX1T1)

Recombinant Human Protein CBFA2T1 (RUNX1T1) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: RUNX1T1. Target Synonyms: Cyclin-D-related protein (Eight twenty one protein; Protein ETO; Protein MTG8; Zinc finger MYND domain-containing protein 2) . Accession Number: Q06455. Expression Region: 1~604aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 75kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Protein CBFA2T1 (RUNX1T1) is a purified Recombinant Protein.

Accession Number

Q06455

Expression Region

1~604aa

Host

E. coli

Target

RUNX1T1

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Field of Research

Cancer

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

75kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Cyclin-D-related protein (Eight twenty one protein; Protein ETO; Protein MTG8; Zinc finger MYND domain-containing protein 2)

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

MISVKRNTWRALSLVIGDCRKKGNFEYCQDRTEKHSTMPDSPVDVKTQSRLTPPTMPPPPTTQGAPRTSSFTPTTLTNGTSHSPTALNGAPSPPNGFSNGPSSSSSSSLANQQLPPACGARQLSKLKRFLTTLQQFGNDISPEIGERVRTLVLGLVNSTLTIEEFHSKLQEATNFPLRPFVIPFLKANLPLLQRELLHCARLAKQNPAQYLAQHEQLLLDASTTSPVDSSELLLDVNENGKRRTPDRTKENGFDREPLHSEHPSKRPCTISPGQRYSPNNGLSYQPNGLPHPTPPPPQHYRLDDMAIAHHYRDSYRHPSHRDLRDRNRPMGLHGTRQEEMIDHRLTDREWAEEWKHLDHLLNCIMDMVEKTRRSLTVLRRCQEADREELNYWIRRYSDAEDLKKGGGSSSSHSRQQSPVNPDPVALDAHREFLHRPASGYVPEEIWKKAEEAVNEVKRQAMTELQKAVSEAERKAHDMITTERAKMERTVAEAKRQAAEDALAVINQQEDSSESCWNCGRKASETCSGCNTARYCGSFCQHKDWEKHHHICGQTLQAQQQGDTPAVSSSVTPNSGAGSPMDTPPAATPRSTTPGTPSTIETTPR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti Human HAND2 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(Western Blot, Immunofluorescence)
MBS8423961-01 0.12 mL

Rabbit Anti Human HAND2 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(Western Blot, Immunofluorescence)

Sign In for Pricing
View Details
Rabbit Anti Human HAND2 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(Western Blot, Immunofluorescence)
MBS8423961-02 0.2 mL

Rabbit Anti Human HAND2 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(Western Blot, Immunofluorescence)

Sign In for Pricing
View Details
Rabbit Anti Human HAND2 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(Western Blot, Immunofluorescence)
MBS8423961-03 5x 0.2 mL

Rabbit Anti Human HAND2 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(Western Blot, Immunofluorescence)

Sign In for Pricing
View Details
Phospho-MEK3 (Thr222) Polyclonal Antibody, APC-Cy7 Conjugated
bs-4123R-APC-Cy7 100 µL

Phospho-MEK3 (Thr222) Polyclonal Antibody, APC-Cy7 Conjugated

Sign In for Pricing
View Details
KleE Antibody
orb820272 2 mg

KleE Antibody

Sign In for Pricing
View Details
Recombinant Ehrlichia chaffeensis Co-chaperonin GroES (groES)
orb2659477-01 20 µg

Recombinant Ehrlichia chaffeensis Co-chaperonin GroES (groES)

Sign In for Pricing
View Details