Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ehrlichia chaffeensis Co-chaperonin GroES (groES)

This Recombinant Ehrlichia chaffeensis Co-chaperonin GroES (groES) spans the amino acid sequence from region 1-94aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

10 kDa chaperonin; Chaperonin-10; Cpn10

UniProt

P42386

Expression Region

1-94aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Ehrlichia chaffeensis

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MNLNMLHDNVLIEALEECNSSSPIQLPDSAKKKPTQGKVVAVGPGVYNHSGNILPMTIKVGDVVFYRQWAGNEIEFHEKKYIVMKESDIIAKEA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Psd3 shRNA (UAS) - Lentiviral mousePsd3 shRNA (UAS, GFP) (25)
GTR15207800 1 Vial

Lentiviral mouse Psd3 shRNA (UAS) - Lentiviral mousePsd3 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Mouse Cnot4 (NM_001164411) AAV Particle
MR219277A1V 250 µL

Mouse Cnot4 (NM_001164411) AAV Particle

Sign In for Pricing
View Details
SGK2 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
43629154 3x 1.0 µg DNA

SGK2 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
Actin-Related Protein 2/3 Complex Subunit 1A (ARPC1A) Peptide
abx616746 100 µg

Actin-Related Protein 2/3 Complex Subunit 1A (ARPC1A) Peptide

Sign In for Pricing
View Details
Mouse Activated Leukocyte Cell Adhesion Molecule (ALCAM) ELISA Kit
NSL0927m 96 Tests

Mouse Activated Leukocyte Cell Adhesion Molecule (ALCAM) ELISA Kit

Sign In for Pricing
View Details
PLV-Tet-miniCMV-CUL4B-GFP-nanobody-mCherry-Puro Plasmid
PVT72432 2 µg

PLV-Tet-miniCMV-CUL4B-GFP-nanobody-mCherry-Puro Plasmid

Sign In for Pricing
View Details