Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Glutathione peroxidase 7 (Gpx7)

Recombinant Mouse Glutathione peroxidase 7 (Gpx7) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Gpx7. Accession Number: Q99LJ6. Expression Region: 19~186aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 26.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Mouse Glutathione peroxidase 7 (Gpx7) is a purified Recombinant Protein.

Accession Number

Q99LJ6

Expression Region

19~186aa

Host

E. coli

Target

Gpx7

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Field of Research

Cell Biology

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

26.7kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

QSEQDFYDFKAVNIRGKLVSLEKYRGSVSLVVNVASECGFTDQNYRALQQLQRDLGPHHFNVLAFPCNQFGQQEPDTNREIENFARRTYSVSFPMFSKIAVTGTGAHPAFKYLTQTSGKEPTWNFWKYLVDPDGKVVGAWDPTVPVAEIKPRITEQVMKLILRKREDL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat anti-IL6R / CD126 (isoform 1) Antibody
dAP-0800 50 µg

Goat anti-IL6R / CD126 (isoform 1) Antibody

Sign In for Pricing
View Details
GRK2 (Phospho-Ser29) Colorimetric Cell-Based ELISA Kit
EKC2073 1 Kit, Containing two 96 Well Plates and all necessary reagents

GRK2 (Phospho-Ser29) Colorimetric Cell-Based ELISA Kit

Sign In for Pricing
View Details
Hoxc6 Rabbit Polyclonal Antibody (FITC)
orb2143678 100 µL

Hoxc6 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Rabbit Polyclonal Nanog Antibody [CoraFluor 1]
NBP1-77109CL1 0.1 mL

Rabbit Polyclonal Nanog Antibody [CoraFluor 1]

Sign In for Pricing
View Details
AMIGO1 Polyclonal Antibody, RBITC Conjugated
bs-11070R-RBITC 100 µL

AMIGO1 Polyclonal Antibody, RBITC Conjugated

Sign In for Pricing
View Details
Mouse Phosphoglucomutase-1 ELISA Kit
MBS2881811-01 48 Well

Mouse Phosphoglucomutase-1 ELISA Kit

Sign In for Pricing
View Details