Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Zinc finger protein GLI1 (GLI1), partial

Recombinant Human Zinc finger protein GLI1 (GLI1), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: GLI1. Target Synonyms: Glioma-associated oncogeneOncogene GLI. Accession Number: P08151. Expression Region: 921~1106aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 23.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Zinc finger protein GLI1 (GLI1), partial is a purified Recombinant Protein.

Accession Number

P08151

Expression Region

921~1106aa

Host

E. coli

Target

GLI1

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Field of Research

Developmental Biology

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

23.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Glioma-associated oncogeneOncogene GLI

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

QEPSYQSPKFLGGSQVSPSRAKAPVNTYGPGFGPNLPNHKSGSYPTPSPCHENFVVGANRASHRAAAPPRLLPPLPTCYGPLKVGGTNPSCGHPEVGRLGGGPALYPPPEGQVCNPLDSLDLDNTQLDFVAILDEPQGLSPPPSHDQRGSSGHTPPPSGPPNMAVGNMSVLLRSLPGETEFLNSSA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Dengue Virus NS1 (DV-NS1) ELISA Kit
MBS9936563-01 48 Strip Well

Mouse Dengue Virus NS1 (DV-NS1) ELISA Kit

Sign In for Pricing
View Details
Mouse Dengue Virus NS1 (DV-NS1) ELISA Kit
MBS9936563-02 96 Strip Well

Mouse Dengue Virus NS1 (DV-NS1) ELISA Kit

Sign In for Pricing
View Details
Mouse Dengue Virus NS1 (DV-NS1) ELISA Kit
MBS9936563-03 5x 96 Strip Well

Mouse Dengue Virus NS1 (DV-NS1) ELISA Kit

Sign In for Pricing
View Details
Mouse Dengue Virus NS1 (DV-NS1) ELISA Kit
MBS9936563-04 10x 96 Strip Well

Mouse Dengue Virus NS1 (DV-NS1) ELISA Kit

Sign In for Pricing
View Details
Grin3a (NM_001033351) Mouse Recombinant Protein
PM43722M5 20 µg

Grin3a (NM_001033351) Mouse Recombinant Protein

Sign In for Pricing
View Details
ADCK5 Blocking Peptide
MBS823438-01 1 mg

ADCK5 Blocking Peptide

Sign In for Pricing
View Details