Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Tityus bahiensis Toxin Tb2-II

Recombinant Tityus bahiensis Toxin Tb2-II is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Tityus bahiensis (Brazilian scorpion) . Target Name: Tityus bahiensis Toxin Tb2-II. Target Synonyms: P-Mice-Ins-beta* NaTx5.4. Accession Number: P60276. Expression Region: 1~62aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 12.0kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Tityus bahiensis Toxin Tb2-II is a purified Recombinant Protein.

Accession Number

P60276

Expression Region

1~62aa

Host

E. coli

Target

Tityus bahiensis Toxin Tb2-II

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

12.0kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

P-Mice-Ins-beta* NaTx5.4

Species

Tityus bahiensis (Brazilian scorpion)

Protein Name

Recombinant Protein

AA Sequence

KEGYAMDHEGCKFSCFIRPSGFCDGYCKTHLKASSGYCAWPACYCYGVPSNIKVWDYATNKC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Actr6 Pre-designed siRNA Set A
SI100209A 1 Each

Mouse Actr6 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Alexa Fluor® 488 Mouse IgG3, κ Isotype Ctrl
GT17378 100 µg

Alexa Fluor® 488 Mouse IgG3, κ Isotype Ctrl

Sign In for Pricing
View Details
Polycystin 1 Polyclonal Antibody, APC-Cy5.5 Conjugated
bs-2157R-APC-Cy5.5 100 µL

Polycystin 1 Polyclonal Antibody, APC-Cy5.5 Conjugated

Sign In for Pricing
View Details
CD Markers CD 161c (mouse)
EBS-CD-114 100 μg

CD Markers CD 161c (mouse)

Sign In for Pricing
View Details
Lad (I249) polyclonal antibody
BS9161-01 50 µL

Lad (I249) polyclonal antibody

Sign In for Pricing
View Details
Lad (I249) polyclonal antibody
BS9161-02 100 µL

Lad (I249) polyclonal antibody

Sign In for Pricing
View Details