Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Macrophage migration inhibitory factor (MIF)

Recombinant Human Macrophage migration inhibitory factor (MIF) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Baculovirus. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: MIF. Target Synonyms: Glycosylation-inhibiting factor (GIF; L-dopachrome isomerase; L-dopachrome tautomerase; Phenylpyruvate tautomerase; GLIF; MMIF; MIF) . Accession Number: P14174. Expression Region: 2~115aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 16.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Macrophage migration inhibitory factor (MIF) is a purified Recombinant Protein.

Accession Number

P14174

Expression Region

2~115aa

Host

Baculovirus

Target

MIF

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Field of Research

Immunology

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

16.2kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Glycosylation-inhibiting factor (GIF; L-dopachrome isomerase; L-dopachrome tautomerase; Phenylpyruvate tautomerase; GLIF; MMIF; MIF)

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

PMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse C57 Intestine, Jejunum Swiss Roll Paraffin Sections*
MP-308-SR-C57 10 Slides

Mouse C57 Intestine, Jejunum Swiss Roll Paraffin Sections*

Sign In for Pricing
View Details
GATAD2A Peptide - N-terminal region
orb1999848 100 µg

GATAD2A Peptide - N-terminal region

Sign In for Pricing
View Details
Bovine Macrophage Inflammatory Protein 3 Alpha (MIP3a/CCL20) ELISA Kit
MBS2610256-01 48 Well

Bovine Macrophage Inflammatory Protein 3 Alpha (MIP3a/CCL20) ELISA Kit

Sign In for Pricing
View Details
Bovine Macrophage Inflammatory Protein 3 Alpha (MIP3a/CCL20) ELISA Kit
MBS2610256-02 96 Well

Bovine Macrophage Inflammatory Protein 3 Alpha (MIP3a/CCL20) ELISA Kit

Sign In for Pricing
View Details
Bovine Macrophage Inflammatory Protein 3 Alpha (MIP3a/CCL20) ELISA Kit
MBS2610256-03 5x 96 Well

Bovine Macrophage Inflammatory Protein 3 Alpha (MIP3a/CCL20) ELISA Kit

Sign In for Pricing
View Details
Bovine Macrophage Inflammatory Protein 3 Alpha (MIP3a/CCL20) ELISA Kit
MBS2610256-04 10x 96 Well

Bovine Macrophage Inflammatory Protein 3 Alpha (MIP3a/CCL20) ELISA Kit

Sign In for Pricing
View Details