Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GATAD2A Peptide - N-terminal region

GATAD2A Peptide - N-terminal region

Product Specifications

Product Name Alternative

P66alpha

UniProt

Q86YP4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_060130.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LGEGREQRPELRKTASSTVWQAQLGEASTRPQAPEEEGNPPESMKPARAS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4921504E06Rik Mouse Gene Knockout Kit (CRISPR)
KN500337 1 Kit

4921504E06Rik Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cldn14 Mouse Gene Knockout Kit (CRISPR)
KN503405 1 Kit

Cldn14 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant VEGFA Antibody
RC-5476-01 50 μL

Recombinant VEGFA Antibody

Sign In for Pricing
View Details
Recombinant VEGFA Antibody
RC-5476-02 100 µL

Recombinant VEGFA Antibody

Sign In for Pricing
View Details
Recombinant VEGFA Antibody
RC-5476-03 1 mL

Recombinant VEGFA Antibody

Sign In for Pricing
View Details
EHMT2/G9A (EHMT2) (NM_025256) Human Recombinant Protein
TP319200 20 µg

EHMT2/G9A (EHMT2) (NM_025256) Human Recombinant Protein

Sign In for Pricing
View Details