Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Complement factor I (Cfi)

Recombinant Mouse Complement factor I (Cfi) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Mammalian Cell. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Cfi. Target Synonyms: C3B/C4B inactivator. Accession Number: Q61129. Expression Region: 19~603aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 69.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Mouse Complement factor I (Cfi) is a purified Recombinant Protein.

Accession Number

Q61129

Expression Region

19~603aa

Host

Mammalian Cells

Target

Cfi

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Field of Research

Epigenetics, Nuclear Signaling

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

69.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

C3B/C4B inactivator

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

RSPSASDLPQEELVDQKCLLQKYTHRSCNKVFCQPWQRCIEGTCICKLPYQCPRAGTPVCAMNGRSYPTYCHQKSFECLHPEIKFSHNGTCAAEGKFNVSLIYGRTKTEGLVQVKLVDQDERMFICKNSWSMAEANVACVDLGFPLGVRDIQGSFNISGNLHINDTECLHVHCRGVETSLAECAFTKRRTELSNGLAGVVCYKQDADFPTSLSFQCVNGKHIPQEKACNGVNDCGDQSDELCCKGCRGNASLCKSGVCIPDQYKCNGEVDCITGEDESRCEEDRQQNIPKGLARSAQGEAEIETEETEMLTPGMDNERKRIKSLLPKLSCGVKRNTHTRRKRVIGGKPANVGDYPWQVAIKDGQRITCGGIYIGGCWILTAAHCVRPSRAHSYQVWTALLDWLKPNSQLGIQTVKRVIVHEKYNGATFQNDIALIEMKMHTGKKECELPNSVPACVPWSPYLFQPNDRCIISGWGRGKDNQKVYSLRWGEVDLIGNCSQFYPDRYYEKEMQCAGTRDGSIDACKGDSGGPLVCEDINNVTYVWGIVSWGENCGKPEFPGVYTRVANYFDWISYHVGRSLVSQHNV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MET (HGF receptor, HGFR, Hepatocyte Growth Factor Receptor, Scatter Factor Receptor, SF Receptor, HGF/SF Receptor, Tyrosine-Protein Kinase Met, Proto-Oncogene c-Met) (FITC) discontinued
M3007-20C-FITC 200 µL

MET (HGF receptor, HGFR, Hepatocyte Growth Factor Receptor, Scatter Factor Receptor, SF Receptor, HGF/SF Receptor, Tyrosine-Protein Kinase Met, Proto-Oncogene c-Met) (FITC) discontinued

Sign In for Pricing
View Details
Homeobox Protein Hox-B9 (HOXB9) Peptide
abx616235 100 µg

Homeobox Protein Hox-B9 (HOXB9) Peptide

Sign In for Pricing
View Details
UBE2B, CT (Ubiquitin-conjugating Enzyme E2 B, Ubiquitin-protein Ligase B, Ubiquitin Carrier Protein B, RAD6 Homolog B, HR6B, Ubiquitin-conjugating Enzyme E2-17kD, RAD6B) (MaxLight 490) discontinued
U0879-90A-ML490 100 µL

UBE2B, CT (Ubiquitin-conjugating Enzyme E2 B, Ubiquitin-protein Ligase B, Ubiquitin Carrier Protein B, RAD6 Homolog B, HR6B, Ubiquitin-conjugating Enzyme E2-17kD, RAD6B) (MaxLight 490) discontinued

Sign In for Pricing
View Details
Anti-ATOX1  (3E1)
YF-MA12049 100 ug

Anti-ATOX1 (3E1)

Sign In for Pricing
View Details
Rabbit p14ARF Recombinant Monoclonal Antibody
orb2302670-01 10 ul

Rabbit p14ARF Recombinant Monoclonal Antibody

Sign In for Pricing
View Details
Rabbit p14ARF Recombinant Monoclonal Antibody
orb2302670-02 100 µL

Rabbit p14ARF Recombinant Monoclonal Antibody

Sign In for Pricing
View Details