Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Peroxisome proliferator-activated receptor alpha (PPARA)

Recombinant Human Peroxisome proliferator-activated receptor alpha (PPARA) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Baculovirus. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: PPARA. Target Synonyms: Nuclear receptor subfamily 1 group C member 1 (NR1C1; PPAR) . Accession Number: Q07869. Expression Region: 1~468aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 56.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Peroxisome proliferator-activated receptor alpha (PPARA) is a purified Recombinant Protein.

Accession Number

Q07869

Expression Region

1~468aa

Host

Baculovirus

Target

PPARA

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Field of Research

Cancer

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

56.2kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Nuclear receptor subfamily 1 group C member 1 (NR1C1; PPAR)

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

MVDTESPLCPLSPLEAGDLESPLSEEFLQEMGNIQEISQSIGEDSSGSFGFTEYQYLGSCPGSDGSVITDTLSPASSPSSVTYPVVPGSVDESPSGALNIECRICGDKASGYHYGVHACEGCKGFFRRTIRLKLVYDKCDRSCKIQKKNRNKCQYCRFHKCLSVGMSHNAIRFGRMPRSEKAKLKAEILTCEHDIEDSETADLKSLAKRIYEAYLKNFNMNKVKARVILSGKASNNPPFVIHDMETLCMAEKTLVAKLVANGIQNKEAEVRIFHCCQCTSVETVTELTEFAKAIPGFANLDLNDQVTLLKYGVYEAIFAMLSSVMNKDGMLVAYGNGFITREFLKSLRKPFCDIMEPKFDFAMKFNALELDDSDISLFVAAIICCGDRPGLLNVGHIEKMQEGIVHVLRLHLQSNHPDDIFLFPKLLQKMADLRQLVTEHAQLVQIIKKTESDAALHPLLQEIYRDMY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LBR (Lamin-B Receptor, Integral Nuclear Envelope Inner Membrane Protein, LMN2R)
129022 50 µg

LBR (Lamin-B Receptor, Integral Nuclear Envelope Inner Membrane Protein, LMN2R)

Sign In for Pricing
View Details
Lentiviral mouse Trp53 shRNA (UAS) - Lentiviral mouse Trp53 shRNA (UAS, RFP) (100)
GTR15192852 1 Vial

Lentiviral mouse Trp53 shRNA (UAS) - Lentiviral mouse Trp53 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
OCT6 Rabbit Polyclonal Antibody (BF350)
orb2546628 100 µL

OCT6 Rabbit Polyclonal Antibody (BF350)

Sign In for Pricing
View Details
TMEM185A (NM_001174092) Human Tagged ORF Clone
RG229841 10 µg

TMEM185A (NM_001174092) Human Tagged ORF Clone

Sign In for Pricing
View Details
Mouse Monoclonal IL-2 Antibody (B-G5) [CoraFluor 1]
NBP3-14593CL1 0.1 mL

Mouse Monoclonal IL-2 Antibody (B-G5) [CoraFluor 1]

Sign In for Pricing
View Details
Fibulin 1 (FBLN1) Polyclonal Antibody
CAU24234-01 100 µL

Fibulin 1 (FBLN1) Polyclonal Antibody

Sign In for Pricing
View Details