Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Growth/differentiation factor 15 (GDF15), partial

Recombinant Human Growth/differentiation factor 15 (GDF15), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: GDF15. Target Synonyms: Macrophage inhibitory cytokine 1; MIC-1NSAID-activated gene 1 protein; NAG-1NSAID-regulated gene 1 protein; NRG-1; Placental TGF-betaPlacental bone morphogenetic protein; Prostate differentiation factor. Accession Number: Q99988. Expression Region: 198~308aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 16.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Growth/differentiation factor 15 (GDF15), partial is a purified Recombinant Protein.

Accession Number

Q99988

Expression Region

198~308aa

Host

E. coli

Target

GDF15

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Field of Research

Cardiovascular

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

16.2kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Macrophage inhibitory cytokine 1; MIC-1NSAID-activated gene 1 protein; NAG-1NSAID-regulated gene 1 protein; NRG-1; Placental TGF-betaPlacental bone morphogenetic protein; Prostate differentiation factor

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

RNGDHCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDLLAKDCHCI

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCMV-EGFP-SLC7A1-Neo Plasmid
PVT64469 2 µg

PCMV-EGFP-SLC7A1-Neo Plasmid

Sign In for Pricing
View Details
LIMS1 Protein Vector (Mouse) (pPB-N-His)
PV196683 500 ng

LIMS1 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Mouse Pigment Epithelium Derived Factor ELISA Kit (PEDF)
RK03110 96 Tests

Mouse Pigment Epithelium Derived Factor ELISA Kit (PEDF)

Sign In for Pricing
View Details
C11orf16 (NM_020643) Human Untagged Clone
SC122894 10 µg

C11orf16 (NM_020643) Human Untagged Clone

Sign In for Pricing
View Details
RAB23 Monoclonal Antibody
bsm-51516M 100 µL

RAB23 Monoclonal Antibody

Sign In for Pricing
View Details
TNF-alpha (APC1, Cachectin, Differentiation inducing factor (DIF), Macrophage cytotoxic factor (MCF), Necrosin, TNF alpha, TNF Macrophage Derived, TNF Monocyte Derived, TNF Superfamily Member 2, TNFA, TNFSF2, Tumor necrosis factor ligand superfamily member 2, Tumor Necrosis Factor Precursor) (BSA & Azide Free) (MaxLight 490)
168881-AF-ML490 100 µL

TNF-alpha (APC1, Cachectin, Differentiation inducing factor (DIF), Macrophage cytotoxic factor (MCF), Necrosin, TNF alpha, TNF Macrophage Derived, TNF Monocyte Derived, TNF Superfamily Member 2, TNFA, TNFSF2, Tumor necrosis factor ligand superfamily member 2, Tumor Necrosis Factor Precursor) (BSA & Azide Free) (MaxLight 490)

Sign In for Pricing
View Details