Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Prohibitin (Phb), partial

Recombinant Mouse Prohibitin (Phb), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Phb. Target Synonyms: B-cell receptor-associated protein 32 (BAP 32) . Accession Number: P67778. Expression Region: 174~272aa. Tag Info: N-Terminal 10Xhis-Tagged. Theoretical MW: 16.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Mouse Prohibitin (Phb), partial is a purified Recombinant Protein.

Accession Number

P67778

Expression Region

174~272aa

Host

E. coli

Target

Phb

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged

Field of Research

Transcription

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

16.2kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

B-cell receptor-associated protein 32 (BAP 32)

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

TFGKEFTEAVEAKQVAQQEAERARFVVEKAEQQKKAAIISAEGDSKAAELIANSLATAGDGLIELRKLEAAEDIAYQLSRSRNITYLPAGQSVLLQLPQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SNAPC5 (Small Nuclear RNA Activating Complex Polypeptide 5 19kDa, snRNA Activating Protein Complex Subunit 5, SNAPc Subunit 5, SNAPC5, snRNA-activating Protein Complex 19kD Subunit, SNAPc 19kD Subunit, SNAP19) (HRP)
MBS6155100-01 0.1 mL

SNAPC5 (Small Nuclear RNA Activating Complex Polypeptide 5 19kDa, snRNA Activating Protein Complex Subunit 5, SNAPc Subunit 5, SNAPC5, snRNA-activating Protein Complex 19kD Subunit, SNAPc 19kD Subunit, SNAP19) (HRP)

Sign In for Pricing
View Details
SNAPC5 (Small Nuclear RNA Activating Complex Polypeptide 5 19kDa, snRNA Activating Protein Complex Subunit 5, SNAPc Subunit 5, SNAPC5, snRNA-activating Protein Complex 19kD Subunit, SNAPc 19kD Subunit, SNAP19) (HRP)
MBS6155100-02 5x 0.1 mL

SNAPC5 (Small Nuclear RNA Activating Complex Polypeptide 5 19kDa, snRNA Activating Protein Complex Subunit 5, SNAPc Subunit 5, SNAPC5, snRNA-activating Protein Complex 19kD Subunit, SNAPc 19kD Subunit, SNAP19) (HRP)

Sign In for Pricing
View Details
PGLYRP1 (Peptidoglycan Recognition Protein 1, MGC126894, MGC126896, PGLYRP, PGRP, PGRP-S, PGRPS, TAG7, TNFSF3L)
250026 50 µg

PGLYRP1 (Peptidoglycan Recognition Protein 1, MGC126894, MGC126896, PGLYRP, PGRP, PGRP-S, PGRPS, TAG7, TNFSF3L)

Sign In for Pricing
View Details
4-(2-Nitrophenyl)morpholin-3-one
TRC-N926065-500MG 500 mg

4-(2-Nitrophenyl)morpholin-3-one

Sign In for Pricing
View Details
GPA33 (NM_005814) Human Over-expression Lysate
LC417048 20 µg

GPA33 (NM_005814) Human Over-expression Lysate

Sign In for Pricing
View Details
CST3 Recombinant Protein
OPCD02471-50UG 50 µg

CST3 Recombinant Protein

Sign In for Pricing
View Details