Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human rhinovirus A serotype 89 Genome polyprotein

Recombinant Human rhinovirus A serotype 89 Genome polyprotein is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human rhinovirus A serotype 89 (strain 41467-Gallo) (HRV-89) . Target Name: Human rhinovirus A serotype 89 Genome polyprotein. Target Synonyms: Genome polyprotein; Cleaved into: P1; Capsid protein VP0; VP4-VP2; Capsid protein VP4; P1A; Virion protein 4; Capsid protein VP2. Accession Number: P07210. Expression Region: 575~866aa. Tag Info: N-Terminal 10Xhis-Tagged. Theoretical MW: 38.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human rhinovirus A serotype 89 Genome polyprotein is a purified Recombinant Protein.

Accession Number

P07210

Expression Region

575~866aa

Host

E. coli

Target

Human rhinovirus A serotype 89 Genome polyprotein

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

38.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Genome polyprotein; Cleaved into: P1; Capsid protein VP0; VP4-VP2; Capsid protein VP4; P1A; Virion protein 4; Capsid protein VP2; P1B; Virion protein 2; Capsid protein VP3; P1C; Virion protein 3; Capsid protein VP1; P1D; Virion protein 1; P2; Protease 2A; P2A; EC 3.4.22.29; Picornain 2A; Protein 2A; Protein 2B; P2B; Protein 2C; P2C; EC 3.6.1.15; P3; Protein 3AB; Protein 3A; P3A; Viral protein genome-linked; VPg; Protein 3B; P3B; Protein 3CD; EC 3.4.22.28; Protease 3C; EC 3.4.22.28; Picornain 3C; P3C; RNA-directed RNA polymerase; RdRp; EC 2.7.7.48; 3D polymerase; 3Dpol; Protein 3D; 3D

Species

Human rhinovirus A serotype 89 (strain 41467-Gallo) (HRV-89)

Protein Name

Recombinant Protein

AA Sequence

NPVENYIDSVLNEVLVVPNIQPSTSVSSHAAPALDAAETGHTSSVQPEDMIETRYVITDQTRDETSIESFLGRSGCIAMIEFNTSSDKTEHDKIGKGFKTWKVSLQEMAQIRRKYELFTYTRFDSEITIVTAAAAQGNDSGHIVLQFMYVPPGAPVPEKRDDYTWQSGTNASVFWQEGQPYPRFTIPFMSIASAYYMFYDGYDGDSAASKYGSVVTNDMGTICVRIVTSNQKHDSNIVCRIYHKAKHIKAWCPRPPRAVAYQHTHSTNYIPSNGEATTQIKTRPDVFTVTNV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MTBP shRNA Plasmid (h)
sc-61080-SH 20 µg

MTBP shRNA Plasmid (h)

Sign In for Pricing
View Details
Recombinant Human T cell receptor beta variable 10-3 (TVBJ3)
orb3004588-01 20 µg

Recombinant Human T cell receptor beta variable 10-3 (TVBJ3)

Sign In for Pricing
View Details
Recombinant Human T cell receptor beta variable 10-3 (TVBJ3)
orb3004588-02 100 µg

Recombinant Human T cell receptor beta variable 10-3 (TVBJ3)

Sign In for Pricing
View Details
Recombinant Human T cell receptor beta variable 10-3 (TVBJ3)
orb3004588-03 1 mg

Recombinant Human T cell receptor beta variable 10-3 (TVBJ3)

Sign In for Pricing
View Details
3,4,5-Trihydroxybenzaldehyde
sc-206707 100 mg

3,4,5-Trihydroxybenzaldehyde

Sign In for Pricing
View Details
ENTPD8 siRNA (Mouse)
CRM8691-01 15 nmol

ENTPD8 siRNA (Mouse)

Sign In for Pricing
View Details